SecReT4
Protein ID: 337267343
T4SS name [ID]Trb [351]
Gene symbol-
Locus tagMesop_2846
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]2950746..2951801 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDF7Y4I4
KEGG IDmop:Mesop_2846
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.9e-62, Aligned region: 104..320
Protein Sequence: 351 a.a.     [Download]
>gi|337267343|ref|YP_004611398.1| P-type conjugative transfer protein TrbG [Mesorhizobium opportunistum WSM2075]
MNQPFGVIATPALRTSALAAALLSGSLLAGCATPQKPPQISYDASVPPLPAAPVAALDERPKPLHVPPGW
VPARGGFAGSTPVARVENANAAARVQPRREGYYNAIQIYPWSEGALYQVYAAPGQITDIALEPGESLTGE
GPIAAGDTARWIIGDTESGAGVTRRVHVLVKPSRSDINTNLVITTDRRSYMIELQSGEKPYMPAVSWAYP
APPAGQARAIPATPVIPVITARNYRYGLTGDAPPWRPVGVYDDGRRVYVEFPRGIVQGEMPSIFVIGPDG
EAQIANSRIYQNTLIVDRLFGAAELRLGSGKRQQTVRIVRTDATKRGLWMSGSNAARNAKNAFRQRGGEQ
S
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|337264537|ref|NC_015675.1|:2950746-2951801 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGAACCAGCCATTCGGTGTCATCGCCACTCCGGCTCTGAGGACGTCGGCGCTTGCCGCGGCGTTGTTGT
CGGGCTCCCTGCTTGCCGGTTGCGCCACACCGCAGAAACCACCTCAGATCTCCTATGACGCGTCCGTGCC
GCCTTTGCCCGCCGCTCCGGTGGCCGCACTCGATGAGAGGCCCAAACCGCTGCACGTTCCACCAGGGTGG
GTCCCGGCCCGCGGCGGTTTCGCCGGCAGCACGCCGGTGGCGCGCGTCGAGAACGCCAACGCGGCGGCGC
GGGTCCAGCCGCGTCGTGAGGGCTATTACAACGCCATTCAGATTTATCCTTGGAGTGAAGGAGCCCTTTA
TCAGGTCTATGCCGCTCCAGGACAGATAACGGACATCGCACTTGAGCCTGGCGAAAGCCTGACTGGTGAA
GGTCCAATCGCGGCGGGCGATACGGCGCGCTGGATCATCGGTGACACCGAAAGCGGAGCGGGCGTCACCA
GGCGCGTCCATGTGCTGGTCAAGCCTTCGCGCTCGGACATCAACACCAATCTCGTCATCACCACCGACCG
GCGCAGCTACATGATCGAGCTGCAATCGGGCGAGAAGCCGTACATGCCCGCCGTGTCATGGGCCTATCCC
GCGCCGCCGGCCGGACAAGCGCGTGCGATCCCCGCGACACCTGTGATTCCCGTCATCACCGCACGCAACT
ACCGCTATGGTCTCACCGGCGACGCGCCCCCCTGGAGGCCCGTCGGCGTCTATGACGACGGCAGGCGGGT
CTATGTCGAGTTTCCACGCGGAATCGTGCAAGGGGAGATGCCGTCCATCTTTGTCATCGGCCCGGACGGC
GAGGCCCAGATTGCCAACAGCCGAATCTACCAGAACACCCTGATCGTCGACCGTCTCTTTGGCGCGGCGG
AACTGCGGCTTGGCAGTGGCAAGCGGCAACAGACCGTCAGGATCGTTCGCACCGATGCCACGAAGAGAGG
TCTGTGGATGTCAGGCAGCAACGCGGCGCGGAATGCAAAGAACGCCTTTCGTCAAAGGGGAGGGGAGCAA
TCATGA
 Primer design