SecReT4
Protein ID: 337270536
T4SS name [ID]Trb [352]
Gene symbol-
Locus tagMesop_6095
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6257357..6258577 [-]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDF7Y1E1
KEGG IDmop:Mesop_6095
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.8e-58, Aligned region: 219..397
Protein Sequence: 406 a.a.     [Download]
>gi|337270536|ref|YP_004614591.1| conjugation TrbI family protein [Mesorhizobium opportunistum WSM2075]
MTDTSHSNAPPKLDPDQLQLRASPRGAVRFRRGVIVAISAAGCGAILGVMIIALQGPALRFKEHAEDLYH
PDHKPTAEGLDSLPRDYSGVKPKAPVLGPPLPGDLGRPILERQRQLGIAPGQEVSAEDQRLAQQAIEARE
SQVLFRIDNRPRSTDLADGGESVQQRPEAPQSGATAGSASVAPAEGDQNNQQRKLDFVSQRSTSGIYNPH
ALQTSASPYQLMAGSVIAASLITGINSDLPGLVVAQVTENVQDTVTGSILLIPQGSRLIGTYDSVVAFGQ
KRALLVWQRIILPDGSSIEIDNLPATDTAGYAGLEDKVDFHTWQLIKGVALATTLGVGTELSLGDNESDL
VKAIRESAQQNVSRAGQRITEKNLNVQPTITIRPGWPLRVIVHKDLLLRPYKIERE
 
Nucleotide Sequence: 1221 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6258577-6257357 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGACCGATACCTCCCACTCCAATGCGCCGCCTAAACTCGATCCCGACCAGCTGCAGCTGCGCGCCTCAC
CCCGCGGTGCTGTGCGCTTCAGGCGGGGGGTGATTGTCGCGATCTCTGCCGCCGGATGTGGTGCCATTCT
GGGCGTCATGATCATTGCGCTTCAGGGACCGGCATTGCGATTCAAAGAGCATGCGGAAGACCTCTACCAT
CCTGACCACAAGCCCACCGCCGAGGGGCTCGACAGCCTGCCCAGGGACTATTCCGGCGTCAAGCCGAAGG
CACCGGTGCTCGGACCGCCGCTACCCGGTGATCTCGGCCGCCCCATCCTCGAGCGGCAGCGCCAACTCGG
AATTGCGCCGGGACAGGAGGTCTCCGCCGAGGATCAACGCCTTGCCCAGCAGGCAATCGAAGCGCGCGAG
TCTCAAGTGTTGTTCCGGATCGATAATCGACCCAGATCGACAGATCTCGCTGACGGCGGGGAGAGTGTAC
AGCAGCGGCCTGAAGCGCCGCAATCCGGAGCGACAGCCGGGTCGGCTTCCGTTGCGCCAGCCGAGGGCGA
TCAAAACAACCAACAGCGCAAGCTGGATTTTGTCAGTCAGCGGAGCACAAGCGGAATCTACAATCCCCAT
GCGCTGCAGACGTCTGCTTCGCCCTACCAACTGATGGCTGGCAGCGTAATCGCGGCAAGCCTCATTACCG
GGATCAATTCCGACCTACCCGGCCTTGTCGTCGCGCAGGTCACAGAGAATGTGCAAGACACAGTCACTGG
CAGCATCTTGCTCATTCCACAAGGTTCCCGGCTGATCGGCACCTATGACAGCGTGGTGGCGTTTGGGCAA
AAGCGCGCATTGCTGGTCTGGCAGCGAATAATCCTGCCGGACGGGTCCTCGATCGAAATCGATAATCTGC
CGGCGACAGACACCGCCGGATATGCGGGGCTTGAGGACAAGGTGGATTTCCACACCTGGCAGCTGATCAA
GGGGGTTGCGCTTGCGACCACGCTTGGCGTGGGTACCGAATTGAGCCTTGGAGACAATGAAAGCGATCTG
GTCAAGGCGATCCGCGAATCCGCCCAGCAGAACGTCAGTCGAGCCGGCCAGCGCATAACTGAGAAAAATC
TCAACGTTCAGCCCACCATAACGATCCGACCAGGCTGGCCACTGCGCGTCATCGTGCACAAGGATCTCCT
GCTGCGACCATACAAAATTGAACGGGAGTGA
 Primer design