SecReT4
Protein ID: 337270537
T4SS name [ID]Trb [352]
Gene symbol-
Locus tagMesop_6096
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6258591..6259619 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDF7Y1E2
KEGG IDmop:Mesop_6096
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.1e-68, Aligned region: 105..324
Protein Sequence: 342 a.a.     [Download]
>gi|337270537|ref|YP_004614592.1| P-type conjugative transfer protein TrbG [Mesorhizobium opportunistum WSM2075]
MTNKAPSLRAALILSASAAVLSACASKPVPPPEIAYDAADFKAASIEKPPEKPVKIVEVPKPLPLPGQLQ
PDPVKFAEDKRSPEERVADANRAATRQPTRYGYVNAVQVYPFTDGALYQLFAAPERVTDIALQPGEKLTA
VSAGDTVRWVIGDTVSGTGDGQRTHVLVKPFAPELTTNLVITTDRRTYHLQLQSTDKTAMAAISWTYSED
QILALSRRNVQADAATPVASNVALENIRFRYSIAGDTPPWRPTRAFDDGSKVYIEFPRRIDQGEAPPLFI
VGADGGNQLVNYRMRGNYYIVDRLFAAAELRLGAKPQQVVRISRIDGGQLPRRMPLFAGFGR
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6259619-6258591 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGACAAATAAAGCCCCATCGCTCCGTGCCGCGCTGATCCTGTCGGCCTCGGCAGCGGTGCTATCCGCCT
GCGCATCCAAGCCGGTGCCGCCGCCCGAGATTGCCTATGACGCTGCCGACTTCAAAGCAGCGTCGATCGA
GAAGCCGCCAGAGAAACCGGTTAAAATCGTCGAGGTGCCAAAGCCGCTACCGCTTCCCGGCCAGTTGCAG
CCTGACCCGGTCAAGTTCGCCGAAGACAAGCGCTCTCCTGAAGAACGCGTTGCCGATGCCAATAGGGCCG
CAACTCGGCAGCCAACCAGGTATGGCTATGTCAACGCGGTCCAGGTCTATCCCTTCACCGATGGCGCGCT
TTATCAGCTCTTTGCCGCGCCGGAGCGCGTCACCGATATCGCTCTGCAGCCGGGCGAGAAACTGACGGCG
GTGTCCGCCGGGGACACGGTCCGCTGGGTCATCGGCGACACCGTCAGTGGCACCGGTGACGGTCAGCGCA
CCCATGTTTTGGTGAAGCCGTTCGCGCCCGAGCTTACCACAAATCTGGTGATCACCACGGATCGACGCAC
CTATCACTTGCAGCTCCAAAGCACGGACAAGACCGCAATGGCGGCCATCTCTTGGACTTACAGCGAAGAC
CAGATCCTTGCGCTCTCCCGGCGAAACGTTCAGGCCGACGCTGCAACGCCGGTCGCATCGAATGTTGCGC
TCGAAAATATCCGCTTCCGCTATTCAATCGCCGGCGACACTCCGCCCTGGAGGCCGACACGGGCCTTTGA
CGACGGCAGCAAAGTCTATATCGAATTCCCCCGGCGCATCGATCAGGGCGAGGCGCCACCGCTCTTCATC
GTCGGTGCCGACGGCGGCAATCAGCTGGTCAACTACCGCATGCGTGGCAACTACTACATCGTCGATCGCC
TGTTCGCCGCGGCCGAACTGCGCCTCGGGGCCAAGCCGCAGCAGGTCGTTCGCATCTCAAGGATTGACGG
CGGGCAATTGCCGCGTCGGATGCCACTCTTTGCCGGTTTCGGCAGGTGA
 Primer design