SecReT4
Protein ID: 337270538
T4SS name [ID]Trb [352]
Gene symbol-
Locus tagMesop_6097
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6259609..6260340 [-]
ProductConjugal transfer protein
Component typeTrbF
UniProt IDF7Y1E3
KEGG IDmop:Mesop_6097
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.2e-61, Aligned region: 22..225
Protein Sequence: 243 a.a.     [Download]
>gi|337270538|ref|YP_004614593.1| Conjugal transfer protein [Mesorhizobium opportunistum WSM2075]
MLFKRSVQRYGKTPEPITPYQKAGQLWDERIGSSRVQARNWRLMALGCLALATGLSGGFVWQSMQSRVVP
YVVEVDRFGEARAVASAIRDYEPTDAQIAWHLGRFIQNIRSVSTDPVLVRQNWLAAYDFASDRAALFLNE
YAKANDPFGQIGTRSVSVQVTSVVRASGSSFQVKWTEQVFERGSLASTTRWTAILTIMIRPPNNTDQLRK
NPLGLFINAIDWSRELDSAAPTSVSPKEPANDK
 
Nucleotide Sequence: 732 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6260340-6259609 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGCTGTTCAAGCGATCCGTTCAACGCTACGGCAAGACACCCGAGCCCATCACACCGTACCAGAAGGCGG
GCCAGCTTTGGGATGAGCGCATCGGCTCATCGCGGGTGCAGGCCCGCAACTGGCGGCTGATGGCTCTTGG
CTGCCTGGCATTGGCGACCGGGCTCTCCGGCGGGTTCGTTTGGCAGTCAATGCAGAGCCGGGTGGTGCCC
TACGTCGTCGAGGTCGACCGCTTCGGCGAGGCGCGCGCCGTAGCCTCGGCAATCCGGGACTACGAGCCGA
CGGACGCCCAGATCGCCTGGCATCTTGGCCGTTTCATTCAGAATATCCGTTCCGTTTCCACCGATCCGGT
GTTGGTGCGGCAGAACTGGTTGGCCGCCTATGACTTTGCCAGTGACCGCGCCGCGCTCTTCCTCAACGAA
TATGCCAAGGCGAACGATCCTTTCGGTCAGATCGGAACGCGAAGCGTGTCCGTCCAGGTGACCAGCGTGG
TGCGGGCTTCCGGCAGCTCGTTCCAGGTCAAATGGACCGAGCAGGTCTTTGAGCGCGGCAGCCTTGCCAG
CACGACCCGCTGGACGGCGATCCTCACCATCATGATCCGCCCGCCCAACAATACAGACCAACTGCGCAAG
AATCCGCTCGGCCTCTTCATCAACGCCATCGATTGGTCGCGCGAGCTCGACAGTGCCGCGCCGACCTCCG
TTTCCCCCAAGGAGCCCGCCAATGACAAATAA
 Primer design