SecReT4
Protein ID: 337270539
T4SS name [ID]Trb [352]
Gene symbol-
Locus tagMesop_6098
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6260341..6261663 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDF7Y1E4
KEGG IDmop:Mesop_6098
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-44, Aligned region: 37..262
Protein Sequence: 440 a.a.     [Download]
>gi|337270539|ref|YP_004614594.1| P-type conjugative transfer protein TrbL [Mesorhizobium opportunistum WSM2075]
MNDLGVIDRFMETFIRYIDSGFGLLSGDVAFLTTTLIGIDITLAGLAWAFAGEPNILGRFIRKVLYVGVF
AFILNNFKNLADIIYRSFAGLGISASAANLSSDSLLRPGRIAATGFEGAWPLLDQASQLLGFPEIFGNAL
TIFVLLVAWFLVIIAFFILSIQLFITILEFKLTTLAGFVLVPFAVWSRSAFLAERVLGNVISSGIKVMVL
AVIVGVGSTLFGEFASALQGKEPDLAAAMSQVLGALALLGLGIFGPGIASGLVSGAPQLGAGAALGTAAA
AAGASLIAGGAAIAGVRMAADGGLAAIRAGTTIGSAASSAWQLGRATSPDSGLSGVAAGMQGVAGAASGA
AVRAARSAAETVGRSADAGRQAAWTATGGSPIASMTETPSGPTTDAAPSWARRLRSQQSARAHRHATMQA
VRDGDRPGGSANPSLNDKDD
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6261663-6260341 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGAACGACCTCGGGGTCATCGATCGCTTCATGGAGACTTTCATCCGCTATATTGACAGCGGGTTTGGTC
TGCTGTCGGGCGATGTCGCCTTCCTCACCACGACCCTGATCGGCATCGACATCACGTTAGCCGGGCTCGC
TTGGGCATTCGCCGGCGAGCCCAACATTCTCGGCCGCTTCATCCGCAAGGTGCTCTATGTCGGCGTCTTC
GCTTTCATCCTGAACAATTTCAAGAATCTCGCCGACATTATATACCGCTCCTTCGCAGGGCTGGGCATCA
GCGCTTCGGCCGCCAATCTGTCGTCCGACAGTCTCCTGCGGCCCGGACGTATTGCTGCCACAGGCTTCGA
GGGCGCGTGGCCGCTGCTGGATCAGGCGAGCCAGCTTCTTGGCTTTCCCGAAATCTTCGGCAACGCGCTC
ACCATTTTCGTGCTGCTCGTGGCCTGGTTCCTGGTCATCATTGCCTTCTTCATTCTTTCCATCCAGCTCT
TCATCACCATTCTGGAGTTCAAGCTCACCACTCTCGCCGGCTTCGTTCTGGTGCCCTTCGCAGTCTGGAG
CAGGTCGGCGTTCCTGGCCGAGCGCGTGCTCGGCAACGTGATCTCGTCGGGCATCAAGGTGATGGTGCTT
GCGGTCATTGTCGGTGTCGGGTCCACGCTGTTCGGCGAGTTCGCTTCGGCGCTGCAAGGCAAGGAGCCGG
ATTTGGCCGCCGCCATGTCACAGGTGTTGGGCGCGCTGGCGCTGCTTGGGCTAGGTATTTTCGGGCCTGG
AATAGCGTCCGGTCTCGTCTCGGGTGCCCCGCAGCTTGGTGCGGGCGCTGCACTGGGTACGGCCGCGGCC
GCCGCCGGTGCGTCACTCATTGCGGGAGGCGCTGCGATCGCTGGGGTGCGCATGGCAGCTGATGGCGGGC
TTGCCGCAATTCGCGCCGGCACCACGATCGGTTCGGCAGCTTCCTCTGCCTGGCAACTAGGACGCGCAAC
CTCGCCTGACTCCGGCCTGTCCGGTGTGGCTGCCGGGATGCAGGGCGTGGCAGGTGCTGCCAGCGGCGCC
GCTGTGCGAGCGGCACGATCTGCCGCGGAAACCGTCGGGCGCAGCGCTGATGCCGGGCGCCAGGCCGCAT
GGACCGCGACCGGCGGGTCTCCCATCGCCTCGATGACCGAAACTCCTTCGGGTCCGACCACCGATGCTGC
CCCTAGCTGGGCCAGGCGCCTGCGTTCCCAGCAGTCTGCGCGAGCCCACCGCCACGCCACCATGCAGGCC
GTGCGCGATGGTGACAGACCGGGCGGTAGCGCCAATCCCTCTCTCAACGACAAGGACGACTAG
 Primer design