SecReT4
Protein ID: 337270540
T4SS name [ID]Trb [352]
Gene symbol-
Locus tagMesop_6099
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6261692..6262417 [-]
ProductP-type conjugative transfer protein TrbJ
Component typeTrbJ
UniProt IDF7Y1E5
KEGG IDmop:Mesop_6099
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 241 a.a.     [Download]
>gi|337270540|ref|YP_004614595.1| P-type conjugative transfer protein TrbJ [Mesorhizobium opportunistum WSM2075]
MMRRRFLSGLITLSLMAKPMADYVQPAYALIVFDPSNYTQNVLTAARSLEQINNQIQSLQNQATMLQNMA
RNLQRLDFSSVGQLTGSLQRIDGLMDQASGLSFDLGKLQDQWRNQYPESYDATIKVSDVASAARERWQSA
MQAFRQTMGVQSQILDNVRGDRDLLADLVNRSQGAAGALEASQATNQLIALSTKQQMQIQTLLATQFRAE
AEDAARKAQSEEAARQTTKRFLGTGTAYPGN
 
Nucleotide Sequence: 726 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6262417-6261692 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGATGCGGCGCCGTTTCCTTTCCGGCCTGATCACCCTTTCCCTGATGGCCAAACCGATGGCCGACTATG
TCCAGCCAGCCTACGCGCTCATTGTCTTCGATCCCTCGAACTACACCCAGAATGTGCTGACGGCGGCACG
CTCACTGGAGCAGATCAATAACCAGATACAGTCGCTCCAGAACCAGGCGACCATGCTACAAAACATGGCG
CGCAACCTTCAGAGGCTGGATTTTTCTTCGGTGGGCCAGCTCACCGGTTCGCTGCAGCGGATCGACGGGC
TCATGGACCAGGCGAGTGGTCTGAGTTTTGATCTGGGCAAGCTGCAGGACCAGTGGCGCAATCAATATCC
CGAAAGCTACGACGCCACGATCAAGGTCAGCGATGTGGCAAGCGCAGCACGCGAGCGCTGGCAGAGCGCC
ATGCAGGCGTTCCGGCAGACGATGGGTGTCCAGTCGCAAATCCTCGACAACGTCCGCGGCGATCGCGACC
TGCTTGCTGATCTCGTCAACCGCAGCCAGGGTGCTGCCGGTGCGCTTGAGGCAAGCCAGGCCACCAACCA
ACTGATCGCGCTCTCAACCAAGCAGCAGATGCAGATCCAGACGCTGCTCGCGACGCAGTTTCGCGCTGAG
GCCGAGGATGCGGCTCGCAAAGCGCAGTCCGAAGAAGCCGCGCGCCAGACGACAAAGCGTTTCCTCGGCA
CCGGCACGGCCTATCCCGGCAACTGA
 Primer design