SecReT4
Protein ID: 337270541
T4SS name [ID]Trb [352]
Gene symbol-
Locus tagMesop_6100
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6262423..6264864 [-]
ProductCagE, TrbE, VirB component of type IV transporter system, conserved region
Component typeTrbE
UniProt IDF7Y1E6
KEGG IDmop:Mesop_6100
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.6e-35, Aligned region: 449..726
CagE_TrbE_VirB [PF03135], Evalue: 1.5e-16, Aligned region: 185..289
CagE_TrbE_VirB [PF03135], Evalue: 1.5e-16, Aligned region: 308..389
Protein Sequence: 813 a.a.     [Download]
>gi|337270541|ref|YP_004614596.1| CagE, TrbE, VirB component of type IV transporter system, conserved region [Mesorhizobium opportunistum WSM2075]
MLNLSEYRGKADRLADHLPWAALVAPGIVLNKDGSFQRSFGFRGPDLESATEAELIGICARANNALRRLG
SGWALFFEAERIEALGYPSSRFPDAASWLVDEERRAAFQGKVAHYESRYHLTLTFMPPPDSQARAQSALV
DSHHSGGEREWRQELTRFRDETGRVLDLLSGFMPEIRALDDAETLTYLHGTISTRRHPVAAPETPIYLDG
ILVDAPLTGGLEPMLGNHHLRTLTILGFPNVTRPGILDALNHQDFPYRWMTRFIPLDKTEATRTLTRLRR
QWFAKRKSIVAILREVVTSEPVPLVDTDAENKALDADAALQALGGDHVGFGYLTTTVTVWDEDHQAAAGK
LRAVERVVNGLGFATIREGVNAVEAWLGSLPGHVYANVRQPLVHTLNLAHLMPLSSVWAGPAANEHLAKV
TQAEAPPLLFASTSGSTPFRLSTHVDDVGHMLIVGPTGAGKSVLVALFALQFRRYAGAQVYVFDKGNSAR
AAILAMGGEHHALRAHGALAFQPLRKIDDPAIRSWAAEWIAGLIAHENVTVTPEAKEAIWSALTSLATAP
AQERTLTGLSVLLQSNALKSALMPYTLDGPFGRLLDADDDRLALSDVQCFETEELMHSQGAVLPVLTYLF
HRLEARFDGRPTLLMLDEAWLYLDNPLFAGRIREWLKVLRKKNVSVIFATQSLADVAGSAIAPAIIESCP
QRIFLPNDRAVEPQAREAYERFGLNERQIELVARATPKRQYYLQSRRGNRLFQLGLGPIALALCGASDPA
SQTQIDRILSEHGQDGFAFHFVNARGLYWAAELLRQFPQPDME
 
Nucleotide Sequence: 2442 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6264864-6262423 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGCTGAATCTCTCCGAATATCGGGGCAAGGCCGACCGACTTGCCGATCATCTGCCTTGGGCCGCACTGG
TGGCACCGGGCATCGTGCTCAACAAGGACGGAAGTTTCCAGCGCTCATTTGGATTTCGCGGGCCTGATCT
CGAGAGTGCAACAGAAGCCGAACTCATCGGCATCTGCGCGCGGGCCAACAATGCGCTCAGACGGCTCGGC
TCCGGCTGGGCATTGTTCTTCGAAGCCGAGCGCATCGAGGCGCTGGGCTACCCAAGCTCGCGTTTCCCCG
ACGCTGCGTCATGGTTGGTCGATGAAGAACGGCGCGCGGCCTTTCAAGGCAAGGTCGCGCACTACGAGAG
CCGCTATCACCTGACGCTGACATTCATGCCGCCGCCGGACAGCCAGGCGCGGGCGCAAAGCGCTCTGGTC
GACTCGCATCATTCCGGAGGCGAGAGAGAGTGGCGCCAGGAACTCACGCGGTTCCGGGACGAGACCGGTC
GCGTGCTGGATCTCCTGTCAGGCTTCATGCCCGAAATACGCGCACTCGATGATGCCGAGACGCTGACTTA
CCTCCACGGCACGATCTCCACCCGCCGCCATCCAGTCGCCGCGCCGGAAACGCCGATCTATCTCGACGGC
ATCCTGGTCGATGCGCCGCTTACCGGCGGCTTGGAGCCGATGCTTGGCAACCACCATCTGCGCACGCTCA
CAATCCTCGGTTTTCCGAATGTCACACGGCCCGGAATTCTCGACGCGCTCAACCATCAGGATTTCCCCTA
CCGCTGGATGACGCGCTTCATTCCGCTGGACAAGACCGAGGCCACCAGGACGCTGACGCGGTTGCGGCGG
CAGTGGTTTGCCAAGCGCAAATCGATCGTGGCCATCCTGCGCGAGGTGGTGACCAGCGAACCCGTCCCGC
TCGTCGACACCGATGCCGAAAACAAGGCGCTCGATGCCGACGCCGCACTCCAGGCGTTAGGCGGCGATCA
TGTCGGGTTCGGCTATCTGACGACGACGGTGACGGTTTGGGACGAGGACCATCAAGCCGCTGCGGGGAAA
CTCCGCGCGGTCGAGCGCGTCGTCAATGGCCTCGGCTTCGCCACGATCCGTGAAGGCGTGAATGCGGTCG
AGGCCTGGCTCGGCTCGTTGCCCGGCCATGTCTATGCCAATGTCCGTCAGCCGCTCGTTCACACATTGAA
CCTCGCCCACTTGATGCCGCTTTCCTCGGTGTGGGCCGGCCCGGCGGCGAACGAGCATCTCGCCAAAGTT
ACACAGGCAGAGGCCCCGCCGCTTCTGTTCGCCTCAACCAGCGGGTCGACACCGTTCCGGCTTTCCACCC
ACGTCGACGATGTCGGCCACATGCTGATCGTCGGACCGACCGGCGCCGGCAAATCGGTTCTCGTTGCCCT
CTTCGCTCTGCAGTTCCGACGCTATGCCGGCGCGCAGGTCTATGTCTTCGACAAAGGCAATTCAGCCCGG
GCCGCAATTCTTGCCATGGGTGGCGAGCATCACGCGCTGCGCGCGCACGGTGCGCTTGCCTTCCAGCCGC
TGCGCAAGATTGACGATCCGGCGATCCGCAGCTGGGCAGCCGAATGGATCGCCGGGCTGATCGCCCATGA
GAACGTCACCGTCACCCCGGAGGCGAAAGAGGCAATCTGGTCGGCACTCACCAGTCTTGCAACGGCGCCG
GCGCAGGAACGCACACTCACCGGCCTGTCGGTCTTGCTTCAGTCCAACGCGCTGAAGTCCGCTTTGATGC
CCTACACGCTCGACGGGCCCTTCGGCCGGTTGCTGGACGCGGATGACGATCGGCTGGCCTTGTCGGATGT
GCAGTGCTTCGAGACCGAAGAGCTGATGCACAGCCAAGGCGCTGTGCTGCCGGTGCTCACCTATCTTTTC
CATCGCCTCGAGGCGCGGTTCGATGGACGACCGACATTGCTCATGCTCGACGAGGCCTGGCTCTATCTCG
ACAATCCGCTCTTTGCGGGGCGTATACGCGAATGGCTGAAGGTGCTGCGCAAGAAGAACGTCTCGGTCAT
TTTCGCCACGCAGTCACTGGCCGACGTCGCTGGCTCTGCAATCGCACCGGCCATCATCGAGAGCTGCCCA
CAGCGCATCTTTCTTCCCAATGACCGTGCCGTGGAACCACAGGCACGGGAAGCCTACGAGCGTTTCGGCC
TGAACGAGCGGCAGATCGAGCTTGTCGCGCGCGCCACGCCGAAGCGGCAATATTATCTGCAATCGCGCCG
CGGCAACCGGCTGTTTCAGCTGGGCTTGGGCCCAATCGCGCTTGCGCTATGCGGCGCCTCCGATCCGGCC
AGCCAGACCCAGATCGACAGGATCCTGTCGGAACACGGACAGGACGGCTTTGCCTTTCATTTCGTGAATG
CCCGCGGGCTCTATTGGGCCGCCGAGCTTCTCCGCCAATTCCCTCAACCAGACATGGAGTAA
 Primer design