SecReT4
Protein ID: 337270542
T4SS name [ID]Trb [352]
Gene symbol-
Locus tagMesop_6101
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6264858..6265130 [-]
Productputative conjugal transfer TrbD transmembrane protein
Component typeTrbD
UniProt IDF7Y1E7
KEGG IDmop:Mesop_6101
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 5.8e-12, Aligned region: 6..85
Protein Sequence: 90 a.a.     [Download]
>gi|337270542|ref|YP_004614597.1| putative conjugal transfer TrbD transmembrane protein [Mesorhizobium opportunistum WSM2075]
MFAREHHIEGFEVPVHRALTEPILLGGAPRAVAILSGTVAAAVGLGLQQWIAGLVLWTCAHTVAVFAARR
DPDFASVLVRHLRLKGWLAC
 
Nucleotide Sequence: 273 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6265130-6264858 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGTTCGCCAGAGAGCACCATATCGAGGGCTTTGAGGTTCCGGTTCACCGGGCACTGACCGAACCAATCT
TGCTCGGCGGCGCGCCGCGAGCGGTGGCCATCCTCAGTGGCACCGTCGCCGCGGCCGTCGGGCTGGGGTT
GCAGCAGTGGATTGCCGGATTGGTGCTGTGGACCTGCGCGCACACCGTGGCTGTCTTCGCGGCCCGCCGC
GACCCCGATTTCGCCAGCGTGCTCGTCCGCCATCTTCGCCTGAAGGGGTGGCTCGCATGCTGA
 Primer design