SecReT4
Protein ID: 337270543
T4SS name [ID]Trb [352]
Gene symbol-
Locus tagMesop_6102
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6265130..6265438 [-]
ProductConjugal transfer protein TrbC
Component typeTrbC
UniProt IDF7Y1E8
KEGG IDmop:Mesop_6102
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.1e-26, Aligned region: 2..92
Protein Sequence: 102 a.a.     [Download]
>gi|337270543|ref|YP_004614598.1| Conjugal transfer protein TrbC [Mesorhizobium opportunistum WSM2075]
MRKKPRFLWATTLAFLLTFPAYAAGSGMPWEQPLQQILESVQGPVAKIIAVIIIISTGLTLAFGDTAGGF
RRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 309 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6265438-6265130 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGCGCAAGAAGCCTCGCTTTCTCTGGGCCACCACGCTCGCGTTTCTTCTCACGTTTCCGGCATACGCCG
CCGGCTCCGGAATGCCCTGGGAGCAGCCGCTGCAGCAGATCTTGGAATCAGTGCAGGGGCCGGTCGCCAA
GATCATCGCGGTCATCATCATCATCAGCACCGGCCTGACACTCGCCTTCGGGGACACGGCAGGTGGGTTC
CGTCGGCTCATCCAGATTGTCTTCGGCCTGTCGATCGCCTTTGCCGCATCGAGCTTCTTCCTCTCCTTCT
TCTCCTTTGGCGGCGGGGCACTCGTCTGA
 Primer design