SecReT4
Protein ID: 337270544
T4SS name [ID]Trb [352]
Gene symbol-
Locus tagMesop_6103
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6265450..6266418 [-]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDF7Y1E9
KEGG IDmop:Mesop_6103
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-90, Aligned region: 22..287
Protein Sequence: 322 a.a.     [Download]
>gi|337270544|ref|YP_004614599.1| P-type conjugative transfer ATPase TrbB [Mesorhizobium opportunistum WSM2075]
MNSHPEADHRRRAMLRTAMGPAITKALSDPSIIEVMVNPDGALRIDRLGEGLVDTGVHIHPTEAERIVRL
VASHVRAEAHADNPIVSAELPSGERFEGLLPPVVLAPCFAIRKPAAKLYSLADYVADGVMLPLQADALKK
AVREQRNILVAGGTSSGKTTLANALLAVVADCHERVILIEDTRELQCAAKDCVALRTRRGSVTLADLVRS
TLRLRPDRIIVGEIRGAEALDMLKAWNTGHPGGIATVHANSARSALYRIEQLAQEAVVTVPRRLIAEAID
LIVFIAGRGSSRRIETIAEVTGLDGSGDYAVTQLTLPQLQQL
 
Nucleotide Sequence: 969 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6266418-6265450 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
GTGAACTCTCATCCGGAAGCCGACCATCGCCGCCGTGCGATGCTGCGCACCGCCATGGGTCCGGCGATCA
CCAAAGCGCTTTCAGACCCATCGATCATCGAGGTGATGGTCAATCCCGACGGAGCACTGCGGATCGATCG
GCTCGGAGAGGGCCTGGTCGACACAGGCGTACACATCCATCCTACCGAGGCGGAGCGCATTGTCCGCCTC
GTCGCTTCCCACGTGCGCGCCGAAGCGCATGCGGATAATCCGATCGTCAGCGCCGAACTGCCCTCGGGCG
AGCGGTTCGAAGGCCTGCTGCCACCTGTGGTGTTGGCGCCATGCTTTGCTATTCGCAAGCCCGCCGCAAA
GCTCTACAGCCTGGCCGATTATGTCGCCGACGGGGTCATGCTGCCGCTGCAGGCTGACGCGTTGAAGAAA
GCCGTCCGCGAGCAGCGCAACATCCTGGTCGCGGGCGGCACCTCATCGGGCAAGACAACCCTTGCCAATG
CGCTGCTAGCCGTGGTCGCCGACTGCCACGAGCGGGTGATCCTGATCGAGGATACGCGCGAACTTCAATG
TGCAGCAAAAGACTGCGTTGCGCTGAGGACCAGGCGTGGTTCTGTCACGCTCGCCGATCTCGTGCGTTCG
ACACTGCGCCTCAGACCCGATCGCATCATCGTCGGCGAGATCAGAGGCGCGGAAGCGCTCGACATGCTGA
AGGCATGGAACACTGGTCACCCAGGCGGCATCGCCACCGTTCACGCGAACTCGGCGCGGTCCGCCCTCTA
CCGCATCGAGCAGCTCGCACAGGAAGCCGTGGTCACCGTTCCCCGCCGGCTCATCGCCGAGGCGATAGAC
CTGATCGTCTTCATCGCCGGCCGCGGATCCTCGCGCCGCATCGAGACGATCGCCGAGGTCACTGGCCTCG
ACGGCAGTGGCGACTACGCCGTCACCCAGCTCACGCTTCCGCAACTCCAGCAACTCTGA
 Primer design