SecReT4
Protein ID: 337270546
T4SS name [ID]Trb [352]
Gene symbol-
Locus tagMesop_6105
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6266944..6268974 [-]
ProductTRAG family protein
Component typeTraG
UniProt IDF7Y1F1
KEGG IDmop:Mesop_6105
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.5e-106, Aligned region: 110..560
TraG-D_C [PF12696], Evalue: 8.2e-33, Aligned region: 407..529
TrwB_AAD_bind [PF10412], Evalue: 1.1e-30, Aligned region: 164..538
AAA_10 [PF12846], Evalue: 1.9e-09, Aligned region: 194..484
Protein Sequence: 676 a.a.     [Download]
>gi|337270546|ref|YP_004614601.1| TRAG family protein [Mesorhizobium opportunistum WSM2075]
MTPTKLLIGQIVVVFAIVMLGVWTATQWCAHMLGHQPPLGAPWFVAAGWPIYKPWKLFEWWYHFDAYAPE
VFDKAGALAGASGFVGCAAAIGGSLWRARQLGSVTTYGSSRWATTQEIVTAGLFRPAGVFLGKLKDRYLR
HDGPEHVMAFAPTRSGKGVGLVVPTLLSWTGSAVIHDIKGENWQLTSGWRSKFSYCLLFNPTDPRSARYN
PLLEVRKGPQEVRDVQNIADILVDPEGALDRRNHWEKTSHSLLVGAVLHVLYAEEEKTLARVATFLSDPQ
RSFSATLQRMMTTNHLGTPDKPEVHPVVASAARELLNKSENERSGVLSTAMSFLGLYRDPTVAAATSTCD
WRIVDLMDAERPISLYLVVPPSDISRTKPLVRLILNQIGRRLTERLEGDPSRSRKHRLLMMLDEFPALGR
LDFFETALAFMAGYGIRAYLIAQSLNQISKAYGENSAILDNCHVRIAFSSNDERTAKRISDALGTATELR
SMRNYAGHRLAPWLSHVMVSRQETARPLLTPGEVMQLPQTDELVLISGLPPLRAQKLRYYEDWNFTERVL
PSPVLRDSPYADRPASRTDDWTGRVRGVDGRLAAGDEIADAAIGDEGGVQQQRHPALAEDQVVLSPEAEQ
DDLFKSVDDDSEPVADKRVMDRISTAARAYGINEGRGDDKDIVPGF
 
Nucleotide Sequence: 2031 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6268974-6266944 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGACGCCCACGAAGTTGCTGATTGGGCAGATCGTCGTCGTATTCGCAATCGTCATGCTCGGCGTGTGGA
CGGCCACGCAGTGGTGCGCGCACATGCTGGGCCATCAGCCGCCACTCGGCGCGCCGTGGTTTGTTGCGGC
TGGCTGGCCGATCTACAAGCCGTGGAAACTGTTTGAATGGTGGTACCATTTTGACGCCTATGCGCCCGAG
GTCTTCGATAAGGCCGGTGCGCTCGCCGGCGCGAGTGGGTTCGTGGGCTGTGCCGCCGCCATCGGCGGTT
CGCTGTGGCGCGCGCGACAGCTCGGATCGGTGACGACCTATGGCTCGTCAAGGTGGGCAACGACTCAGGA
GATCGTGACGGCAGGGCTGTTTCGGCCGGCCGGGGTTTTCCTAGGCAAGCTGAAGGATCGCTATCTGCGA
CATGACGGGCCCGAGCACGTCATGGCCTTTGCCCCAACACGTTCAGGCAAGGGCGTCGGACTGGTTGTTC
CAACTCTTCTGTCCTGGACCGGTTCGGCGGTCATTCATGATATCAAAGGCGAGAATTGGCAGTTGACCTC
CGGCTGGCGGTCGAAATTCTCCTATTGCCTTCTATTCAATCCGACGGATCCTAGGTCGGCGCGCTATAAC
CCGCTGCTTGAGGTACGAAAGGGTCCACAAGAGGTCCGCGATGTTCAGAACATCGCCGACATCCTGGTAG
ATCCGGAAGGCGCGCTGGACCGCCGGAATCACTGGGAAAAGACAAGTCATTCCCTCCTCGTCGGCGCCGT
TTTGCACGTGCTCTATGCCGAAGAGGAAAAGACGCTTGCCCGCGTGGCCACTTTCCTGTCGGACCCGCAA
CGTTCCTTTTCCGCGACGCTGCAGCGGATGATGACCACCAACCACCTGGGCACGCCCGACAAGCCTGAGG
TCCATCCGGTCGTGGCCTCGGCGGCACGTGAGCTGCTGAACAAATCGGAAAACGAGCGTTCGGGTGTTTT
GTCGACCGCCATGTCATTTCTCGGGCTCTATCGCGACCCGACGGTCGCGGCGGCAACATCGACCTGCGAC
TGGCGCATTGTCGATCTCATGGATGCCGAGCGACCGATATCGCTCTACCTGGTCGTGCCGCCGTCGGACA
TCTCGCGCACCAAGCCCTTGGTGCGCCTGATCCTGAACCAGATCGGCAGACGCCTGACCGAGCGCCTTGA
GGGCGATCCAAGCAGGAGTCGCAAACATCGACTCCTCATGATGCTCGACGAATTCCCGGCGCTCGGGCGG
TTAGATTTCTTCGAGACCGCGCTCGCCTTCATGGCCGGCTATGGCATTCGCGCATACCTGATCGCGCAAT
CATTGAACCAGATATCCAAGGCCTATGGCGAGAACAGTGCCATTCTCGACAACTGCCACGTGCGTATTGC
CTTTTCCTCCAATGACGAACGCACCGCCAAGCGCATTTCGGATGCGCTCGGCACCGCAACGGAGCTTAGA
TCGATGCGCAACTATGCCGGCCACCGGCTGGCGCCCTGGCTGTCGCACGTCATGGTCAGCCGGCAGGAAA
CGGCCCGACCGCTGCTCACTCCTGGCGAGGTGATGCAGCTGCCCCAAACCGACGAGCTGGTGCTGATTTC
AGGGCTGCCGCCGTTGCGCGCCCAGAAGCTGCGCTATTATGAGGACTGGAATTTTACCGAACGCGTGCTA
CCTTCCCCGGTGCTGCGGGACAGCCCTTACGCGGACCGTCCGGCTTCGCGCACGGATGACTGGACTGGAC
GGGTGCGCGGCGTTGACGGTCGTCTGGCTGCGGGCGACGAAATTGCCGACGCGGCGATCGGGGACGAGGG
CGGCGTCCAGCAGCAGCGCCATCCAGCTCTAGCGGAAGATCAAGTCGTGCTTTCTCCAGAAGCTGAGCAG
GACGATCTCTTCAAGTCTGTTGACGATGATAGCGAGCCGGTCGCCGACAAACGTGTCATGGATCGGATTT
CGACGGCGGCCCGCGCCTACGGCATCAATGAGGGAAGGGGCGACGACAAGGACATCGTGCCCGGCTTCTG
A
 Primer design