SecReT4
Protein ID: 337270550
T4SS name [ID]Trb [352]
Gene symbol-
Locus tagMesop_6109
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6273902..6274585 [-]
Productlytic transglycosylase catalytic subunit
Component typeTrbN
UniProt IDF7Y1F5
KEGG IDmop:Mesop_6109
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 227 a.a.     [Download]
>gi|337270550|ref|YP_004614605.1| lytic transglycosylase catalytic subunit [Mesorhizobium opportunistum WSM2075]
MDRVALLMLGMIAVAPCACSASTGAEPVAISQSPQLRRWHEFTGEASKRFRVPEAWIYAVIDAESSGKTM
LHGRPITSRAGAMGLMQVMPETYQDMRAQYGLGADPHDPRDNILAGTAYLRAMYDRFGFPGLFAAYNAGP
ERYQAHLKRGTPLPKETVDYLKQLRAAGVSGTDIEQFKGKSVAPSRQDAPSGRSLFFPQNGDRAGARNGD
LFVPLGSDVAQVKEPER
 
Nucleotide Sequence: 684 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6274585-6273902 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGGACCGAGTAGCCCTCCTGATGCTTGGCATGATCGCTGTCGCGCCATGCGCCTGTTCCGCCTCGACCG
GCGCTGAGCCGGTCGCCATCTCCCAAAGTCCGCAACTTCGAAGGTGGCATGAGTTCACAGGCGAAGCAAG
CAAGCGTTTCCGTGTTCCCGAGGCCTGGATTTACGCGGTGATCGATGCCGAAAGCAGCGGCAAGACGATG
CTCCACGGCCGGCCGATCACCTCGCGCGCCGGTGCCATGGGCCTCATGCAGGTGATGCCGGAAACCTATC
AGGACATGCGTGCGCAATACGGACTGGGCGCCGATCCCCACGATCCGCGCGACAACATTCTGGCCGGCAC
TGCCTATCTTCGGGCCATGTATGACCGCTTCGGGTTCCCCGGTCTGTTTGCCGCTTACAACGCCGGACCC
GAGCGCTACCAGGCGCATCTGAAGCGCGGCACGCCGCTGCCGAAAGAGACCGTCGATTACCTCAAGCAGC
TCCGGGCGGCCGGAGTTTCGGGAACCGACATCGAGCAGTTCAAGGGCAAATCTGTCGCTCCAAGCAGGCA
AGATGCACCCTCGGGGCGCTCGCTGTTTTTCCCGCAAAATGGTGATCGCGCCGGCGCGCGAAACGGCGAT
CTCTTCGTGCCGCTGGGAAGCGACGTCGCACAGGTCAAGGAGCCGGAACGCTAG
 Primer design