SecReT4
Protein ID: 337270609
T4SS name [ID]VirB [12]
Gene symbol-
Locus tagMesop_6172
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6328139..6329179 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDF7Y2N1
KEGG IDmop:Mesop_6172
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-57, Aligned region: 15..312
Mg_chelatase [PF01078], Evalue: 6.8e-05, Aligned region: 156..201
Protein Sequence: 346 a.a.     [Download]
>gi|337270609|ref|YP_004614664.1| P-type DNA transfer ATPase VirB11 [Mesorhizobium opportunistum WSM2075]
MQSEADPQLRLLLDPVLKWLEEPRTEEVAINRPGEAFVRQAGVFTKHPLPLSYDDLEDIAILAGALRKQD
VGPQSPLCATELPNGERLQICLPPAVPSGTISLTIRRPSSRVTELKEVSSRYEYSRWNQWRSRKERQERQ
DETILQHYDHGDLEQFLRACVCGRLTMLLCGPTGSGKTTMSKTLINAIPPHERLISIEDTLELAIPHENH
VRLLYPKDRAGAGAVTAEQLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHAGSISTIHGADPVQGFK
KLFSLVKSSAQGAAVEDRTLLDMLSAAIDVIIPFRTQGDVYEVGEVWLAADARRRGETVADLLNKH
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6329179-6328139 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGCAATCGGAGGCTGATCCTCAATTGCGTTTGCTTCTCGATCCCGTTCTGAAATGGCTTGAGGAGCCAA
GAACCGAAGAGGTCGCTATCAACCGGCCTGGGGAAGCCTTTGTCCGACAGGCCGGCGTTTTCACGAAACA
TCCACTGCCGCTGTCTTATGACGATCTGGAGGACATCGCGATCCTCGCCGGAGCGCTGCGCAAGCAAGAT
GTCGGACCGCAAAGCCCCCTCTGCGCGACTGAGTTGCCGAACGGAGAGCGGCTGCAGATCTGTTTGCCCC
CCGCAGTACCCTCAGGAACAATAAGCCTGACGATACGGCGTCCCTCAAGTCGTGTGACCGAACTCAAGGA
AGTTTCTTCTCGCTACGAGTATTCGCGTTGGAATCAATGGCGGTCACGAAAAGAGCGCCAAGAGCGGCAG
GACGAAACGATTCTTCAGCACTACGACCATGGTGACTTGGAGCAATTTTTGCGAGCCTGCGTCTGCGGGC
GGCTCACAATGCTGCTTTGCGGACCTACTGGAAGCGGCAAAACGACAATGAGCAAGACTTTGATCAACGC
TATACCCCCGCATGAGAGGTTGATCAGCATCGAGGACACGCTCGAACTTGCAATCCCGCACGAGAACCAT
GTCCGCTTACTCTATCCAAAGGACCGAGCAGGCGCAGGGGCGGTGACGGCCGAGCAACTGTTGCAAGCCA
GCTTGCGCATGCGCCCTGATCGAATATTGCTTGGCGAGATGCGCGATGACGCCGCTTGGGCCTACCTTAG
TGAAGTCGTCTCCGGCCATGCGGGATCGATATCAACGATTCATGGGGCTGATCCGGTACAAGGTTTCAAG
AAGCTCTTTTCACTCGTCAAGAGCAGCGCGCAAGGAGCCGCTGTCGAAGACCGCACGCTTCTTGACATGC
TGTCGGCCGCCATTGACGTCATCATACCGTTCCGTACCCAAGGCGACGTGTATGAGGTAGGAGAGGTATG
GCTCGCCGCCGATGCCCGGCGACGGGGAGAGACAGTAGCCGACCTTCTCAACAAGCACTAA
 Primer design