SecReT4
Protein ID: 337270612
T4SS name [ID]VirB [12]
Gene symbol-
Locus tagMesop_6175
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6331180..6331893 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDF7Y2N4
KEGG IDmop:Mesop_6175
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-44, Aligned region: 23..227
Protein Sequence: 237 a.a.     [Download]
>gi|337270612|ref|YP_004614667.1| VirB8 family protein [Mesorhizobium opportunistum WSM2075]
MKFPEHALLVERETLAAHYKKVEAFQTSRAKSARRLSKALIAFAAAAVLGNVAQAFTIAAMVPLAKLVPV
FLWVRPDGTVDSEVSISRLPATQDRAVINASLWEYVRLREGYTADTAQYAYDLVSSFSAPSVQQQYQDFF
NYPNPTSPQVTVGKRGKLEVGHISSNDISPDVQQIRYKRTLVIDGQTPIVTSWTATIRYERLTGLPGQSR
LTNPGGLLVTSYQASQDTVSNLGFVQP
 
Nucleotide Sequence: 714 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6331893-6331180 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
GTGAAATTTCCTGAACATGCCCTTCTGGTGGAGAGAGAAACGCTAGCCGCTCACTATAAGAAGGTGGAAG
CGTTTCAAACTTCTCGAGCGAAGTCTGCGCGGCGCTTGTCAAAGGCGCTTATAGCCTTTGCCGCAGCGGC
GGTCCTGGGAAATGTCGCCCAGGCATTTACCATCGCTGCCATGGTCCCGTTGGCCAAGCTCGTACCTGTG
TTCCTCTGGGTGCGGCCGGACGGTACCGTTGACAGCGAAGTGTCAATCTCTCGACTGCCGGCAACCCAAG
ACCGAGCCGTCATAAACGCTTCGCTATGGGAATATGTACGCCTTCGCGAGGGCTACACGGCAGATACAGC
CCAATACGCCTATGACCTCGTCTCCAGTTTCAGCGCACCTTCTGTGCAACAGCAATATCAAGATTTCTTC
AACTATCCCAACCCCACCTCGCCGCAGGTCACGGTTGGGAAGCGCGGCAAGCTCGAGGTCGGGCATATTT
CATCAAATGACATCAGTCCCGACGTTCAGCAGATCCGATACAAACGTACGCTTGTTATCGATGGGCAGAC
GCCGATAGTGACCTCCTGGACTGCTACCATCCGCTACGAGCGCTTGACGGGTCTGCCTGGGCAATCGAGG
CTCACCAATCCGGGAGGTCTACTCGTCACATCCTATCAAGCCTCGCAAGACACCGTATCGAACCTGGGCT
TCGTGCAGCCATGA
 Primer design