SecReT4
Protein ID: 337270613
T4SS name [ID]VirB [12]
Gene symbol-
Locus tagMesop_6176
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6331890..6332048 [-]
ProductVirB7 family protein
Component typeVirB7
UniProt IDF7Y2N5
KEGG IDmop:Mesop_6176
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 52 a.a.     [Download]
>gi|337270613|ref|YP_004614668.1| VirB7 family protein [Mesorhizobium opportunistum WSM2075]
MKRYLLLLILALAACKTTDRLATCTGTPFQLNAGQWETTPEDLQVECAEEPK
 
Nucleotide Sequence: 159 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6332048-6331890 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGAAACGCTATCTACTGTTGCTAATCCTCGCTTTGGCGGCCTGCAAGACAACCGATCGGCTTGCGACCT
GCACGGGTACGCCATTCCAACTGAACGCGGGACAATGGGAAACCACTCCTGAGGATCTTCAGGTCGAGTG
CGCGGAAGAGCCCAAGTGA
 Primer design