SecReT4
Protein ID: 337270624
T4SS name [ID]VirB [12]
Gene symbol-
Locus tagMesop_6190
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]6345446..6347191 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDF7Y2P6
KEGG IDmop:Mesop_6190
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.5e-146, Aligned region: 97..538
TraG-D_C [PF12696], Evalue: 2.9e-29, Aligned region: 391..509
TrwB_AAD_bind [PF10412], Evalue: 2.9e-26, Aligned region: 137..519
AAA_10 [PF12846], Evalue: 5.1e-07, Aligned region: 140..467
Protein Sequence: 581 a.a.     [Download]
>gi|337270624|ref|YP_004614679.1| TRAG family protein [Mesorhizobium opportunistum WSM2075]
MPSTKTTTPNLAVSIACSLAVGFCAASLYATFRHGGGGEALMAFDVRAFWFETPFYLGFATPVFYRGAAI
VLSTSVVVLLIQQVVLRRKLEHHGTARWARVDEMRRTGYLRRYRGVKGPVFGKTSGPFWPGYYLTNGEQP
HSLIVAPTRAGKGVGVVIPTLLTFKGSVIALDVKGELFELTSRARKAAGDDVFKFAPLDSERRTNCYNPL
LDLIALPPQLQFTEARRLAANLITAKGEGAEGFISGARDIFVAGILACIERGTPTIGAVYDLFAQPGEKF
KLFAQLAMETRNKEAQRIFDDMAGNDTKILTSYTSVLGDGGLNLWADPAVKAATSRSDFSVYDLRRRRTC
IYLCVGPNDLEVIAPLIRLFFQQIVSILQRSLPRPEEKHEVLFLLDEFKHLGKLEAIETAITTIAGYKGR
FMLIIQSLSALTGAYGEAGKQNFLSNTGLQVFMATADDETPNYISKAIGEYTFEAKSISYSQARRFDWNI
QNSHQGAPLLRPEQVRLLDDDYEIVLIKGLPPLQLRKVRYFSDRILKRIFEGQTGALPEPAPLTEAEEEL
STDFRLDEPPRGLAQEFNDTV
 
Nucleotide Sequence: 1746 bp     [Download]
>gi|337264537|ref|NC_015675.1|:c6347191-6345446 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGCCTTCAACCAAAACGACGACCCCCAACCTAGCCGTTAGCATCGCCTGCTCGCTCGCCGTGGGCTTCT
GTGCGGCAAGTCTGTACGCAACCTTCCGCCACGGCGGTGGCGGCGAGGCCTTGATGGCGTTTGATGTCCG
TGCCTTTTGGTTTGAGACGCCCTTCTATCTGGGTTTCGCAACCCCCGTCTTCTATCGGGGCGCGGCTATC
GTGCTCTCGACATCCGTGGTCGTCTTGCTGATTCAGCAGGTCGTGTTGCGCCGCAAGCTCGAACACCACG
GGACGGCTCGTTGGGCTCGAGTGGATGAAATGCGACGCACCGGATATCTGCGACGATACCGTGGCGTGAA
AGGACCGGTATTTGGGAAGACGAGTGGCCCTTTCTGGCCTGGCTACTACCTGACCAATGGCGAGCAGCCT
CACAGCCTCATCGTTGCACCGACCCGCGCTGGCAAGGGCGTCGGCGTAGTCATTCCAACGCTACTTACAT
TCAAAGGCTCAGTGATAGCTCTGGACGTCAAGGGGGAGCTCTTTGAGCTCACCTCGAGGGCGCGCAAAGC
CGCAGGCGATGACGTGTTCAAATTCGCGCCGCTGGATTCGGAGCGGCGCACGAACTGCTACAATCCACTG
TTGGACCTTATAGCGCTGCCTCCACAGCTCCAATTCACGGAAGCCCGCCGCTTGGCCGCAAACCTGATTA
CGGCCAAGGGGGAAGGCGCGGAAGGTTTCATCAGCGGCGCGCGAGATATCTTTGTCGCGGGGATCCTTGC
CTGCATCGAGCGGGGTACGCCGACAATCGGCGCCGTCTATGATCTCTTCGCCCAGCCGGGGGAGAAGTTT
AAGCTCTTCGCGCAACTCGCGATGGAGACCCGGAACAAAGAGGCTCAACGCATCTTCGACGACATGGCGG
GGAACGACACAAAAATACTGACCTCCTACACGTCAGTGCTCGGCGATGGCGGGCTCAATCTCTGGGCGGA
TCCCGCTGTTAAGGCGGCCACAAGTCGCTCGGACTTTTCGGTGTATGATCTTCGCCGTCGCAGAACGTGC
ATCTATCTTTGCGTTGGTCCGAACGACCTTGAGGTGATCGCGCCTTTGATACGCTTGTTTTTTCAGCAGA
TCGTTTCAATTCTACAGCGGTCGCTGCCCCGCCCGGAGGAAAAGCACGAGGTTCTCTTCCTGCTCGATGA
GTTCAAGCACTTGGGTAAGCTGGAGGCGATCGAGACCGCAATTACGACTATCGCGGGCTACAAGGGGCGT
TTCATGCTCATCATCCAAAGCCTTTCGGCACTGACAGGGGCTTATGGAGAGGCTGGCAAGCAGAATTTTC
TCAGCAATACCGGCCTGCAAGTGTTCATGGCAACGGCCGATGACGAGACCCCAAATTACATTTCCAAAGC
CATCGGTGAATACACGTTTGAAGCCAAATCGATTTCCTACAGCCAGGCGCGAAGATTCGATTGGAACATT
CAGAATTCGCATCAAGGTGCACCGCTGTTGCGTCCCGAACAGGTTCGGCTGCTCGACGACGACTACGAGA
TCGTTCTCATCAAAGGTCTGCCACCATTGCAATTGAGGAAGGTGCGATATTTTTCGGACCGCATTCTGAA
ACGCATCTTTGAAGGCCAGACAGGCGCCCTCCCGGAGCCGGCACCGTTGACGGAAGCAGAGGAGGAACTC
TCCACAGACTTTCGACTCGATGAGCCGCCGCGTGGATTGGCGCAGGAATTTAACGATACCGTTTGA
 Primer design