SecReT4
Protein ID: 337739065
T4SS name [ID]VirB [199]
Gene symbolvirD4
Locus tagOCA5_pOC16701110
StrainOligotropha carboxidovorans OM5
Repliconplasmid pOC167 [GenBank: NC_015685] [Browse all T4SS(s) in this replicon]
Location [Strand]106909..109065 [-]
Producttype IV secretion protein VirD4
Component typeVirD4
UniProt IDB6JK53
KEGG IDoca:OCAR_7705, ocg:OCA5_pOC16701110
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.8e-78, Aligned region: 146..553
TraG-D_C [PF12696], Evalue: 1.1e-23, Aligned region: 402..522
TrwB_AAD_bind [PF10412], Evalue: 2.6e-20, Aligned region: 149..485
Protein Sequence: 718 a.a.     [Download]
>gi|337739065|ref|YP_004634424.1| type IV secretion protein VirD4 [Oligotropha carboxidovorans OM5]
MARVVAYRIGVAILLLLAFWLLWSMAYEIVVALRWAPGRFPSEGTTRWALFRMQNADRSADFFVIAWRHF
YNRLLFPGTQLEALIRAGYAAATVGAIGLAGALFAVINRRQMPYGAARFGTLMEAAKQGLTAKRGIVLGT
LSGATLRSDEPAHILVVGPSRSGKGTGFVLPNGYLWQGSAVFFDPKRENFEALAEHRAAMGNKVFMFSPG
SNDTHRYNPLDFVRRDERMATDCLVVASFVIPEKADDTWAGAGRLLLSALIGYVLASPLIAGAQHMRTVA
RMTTTGKDISSVLRAIVKTERQHLPAWVVDSFNQYIALEPETRNSAVFNVNMAMSLWNNGLISAATETSD
FDIRELRRRPMTIFIGCTIAELSIFRPLIRILFQQIHDLMMVKIPGDDEPHQVLLMLDEFYHVGRMDSLI
SKITISAGYGFRMAIVMQDIAQLDELYGRNTRITTVSGSQIKLFIQINDLETSDFVSEMLGETTQVYKTP
IQRPGQGIFAPRVWAPHYTPRPLRSPLELREMSARLSILMVKNSRSFELTKIRHYLDKPYRAYYERAKGS
SPALPKLRTWQDEALRGAINPAPDTPQEPATTASPSTAPPPPTSAPARKVTTSRRSAKSTTTKAKTSEPL
REFAPLTLSSPRPTPPTPPRKALSLGATPPVPPGESCDVRDILASAAAGQDEHFTAMVSVLRSTPDTKVQ
QSIEMLRSLHQIFGDDEQ
 
Nucleotide Sequence: 2157 bp     [Download]
>gi|337738957|ref|NC_015685.1|:c109065-106909 Oligotropha carboxidovorans OM5 plasmid pOC167, complete sequence
ATGGCGCGCGTCGTCGCCTATAGGATCGGCGTCGCGATCCTGCTGCTGCTCGCCTTCTGGCTGCTGTGGA
GCATGGCCTATGAGATTGTCGTTGCCCTGCGCTGGGCGCCGGGCCGCTTCCCGAGTGAGGGCACCACCCG
CTGGGCGCTGTTCCGGATGCAGAACGCCGATCGCTCCGCCGACTTCTTTGTGATCGCCTGGCGTCATTTC
TACAACCGACTCCTGTTCCCAGGCACCCAACTCGAGGCACTGATCCGCGCCGGCTATGCGGCGGCCACTG
TTGGCGCGATCGGACTCGCGGGGGCGCTGTTCGCGGTCATCAATCGCCGCCAGATGCCGTATGGCGCCGC
CCGCTTCGGCACGCTGATGGAGGCGGCCAAGCAGGGCCTGACCGCCAAGCGCGGGATCGTGCTGGGAACG
CTGAGCGGCGCCACGCTCCGCTCGGACGAGCCCGCACATATCCTGGTCGTCGGACCATCACGCTCCGGCA
AGGGCACCGGCTTCGTCCTCCCGAATGGCTATCTTTGGCAGGGTTCGGCCGTGTTCTTCGATCCGAAGCG
CGAAAACTTCGAAGCGCTTGCGGAACATCGCGCCGCGATGGGCAACAAGGTTTTTATGTTCTCGCCGGGA
TCCAACGACACGCATCGATACAATCCGCTCGATTTCGTACGGCGCGACGAGCGCATGGCGACCGACTGCC
TGGTCGTCGCCTCCTTTGTGATTCCTGAAAAAGCCGACGACACCTGGGCCGGAGCCGGCCGTCTTCTGCT
CTCGGCGTTAATCGGCTACGTGCTGGCTTCACCGTTGATCGCGGGCGCACAGCACATGCGCACGGTGGCC
CGGATGACGACGACCGGCAAGGATATCTCCTCGGTGCTGCGTGCGATCGTGAAGACTGAACGACAGCACT
TGCCGGCATGGGTGGTCGACAGCTTCAACCAGTACATCGCGTTGGAGCCCGAGACCCGCAACAGCGCCGT
GTTCAACGTCAATATGGCGATGTCGCTGTGGAACAACGGCCTCATCTCGGCCGCGACCGAGACATCCGAT
TTCGACATTCGCGAGCTACGGCGCCGTCCGATGACGATTTTCATCGGCTGTACCATCGCCGAACTGTCGA
TCTTCCGGCCGCTAATCCGCATCCTGTTTCAGCAGATCCACGATCTGATGATGGTGAAGATTCCGGGTGA
CGACGAGCCGCATCAGGTGCTGCTCATGCTCGACGAATTCTACCATGTCGGCCGAATGGACTCTTTGATC
TCGAAGATCACGATCAGCGCGGGATATGGCTTCCGGATGGCGATCGTGATGCAGGACATTGCGCAGCTCG
ACGAACTCTACGGCAGGAACACGCGCATCACCACGGTCTCGGGCTCGCAGATCAAGCTGTTCATCCAGAT
CAACGATCTCGAAACCTCGGACTTTGTGTCCGAGATGCTCGGCGAAACGACACAAGTCTATAAAACGCCG
ATCCAGCGTCCAGGACAGGGCATTTTCGCGCCGCGCGTCTGGGCACCTCACTATACACCGCGCCCGCTGC
GCAGCCCGCTCGAACTCCGCGAGATGTCGGCCCGGCTGTCAATCCTGATGGTCAAGAACTCCCGCTCGTT
CGAATTGACCAAAATCCGGCACTACTTAGATAAACCCTATCGCGCGTATTACGAACGGGCAAAGGGCTCT
TCGCCGGCGCTGCCCAAACTGCGCACCTGGCAAGATGAGGCGCTGCGCGGGGCAATCAATCCGGCGCCTG
ACACGCCCCAAGAACCGGCCACGACCGCAAGCCCGTCGACAGCGCCACCGCCACCCACATCGGCGCCGGC
TCGCAAGGTGACCACATCCCGTCGAAGCGCGAAAAGCACAACAACCAAAGCGAAGACCTCCGAACCGCTG
CGAGAATTTGCCCCTCTCACTCTCTCTTCGCCGCGTCCAACACCGCCAACCCCGCCGCGCAAGGCGCTGT
CGCTCGGCGCAACGCCTCCCGTTCCTCCGGGAGAAAGCTGCGACGTGCGGGACATTCTCGCATCTGCCGC
TGCAGGACAGGACGAACATTTCACCGCAATGGTGAGTGTGTTGCGTTCAACACCAGACACGAAGGTCCAG
CAAAGTATCGAGATGCTTAGGTCTTTACACCAAATCTTTGGCGACGACGAACAGTGA
 Primer design