SecReT4
Protein ID: 337739066
T4SS name [ID]VirB [199]
Gene symbolvirB11
Locus tagOCA5_pOC16701120
StrainOligotropha carboxidovorans OM5
Repliconplasmid pOC167 [GenBank: NC_015685] [Browse all T4SS(s) in this replicon]
Location [Strand]109043..110101 [-]
Producttype IV secretion protein VirB11
Component typeVirB11
UniProt IDB6JK52
KEGG IDoca:OCAR_7704, ocg:OCA5_pOC16701120
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.9e-88, Aligned region: 17..317
Protein Sequence: 352 a.a.     [Download]
>gi|337739066|ref|YP_004634425.1| type IV secretion protein VirB11 [Oligotropha carboxidovorans OM5]
MNVLARSLTVFIDRALDPIRTWLDDDHVVEICVNGPAEVWVERFGQAAMERHEVPSLTEHAIRHLAERVA
GHSGQSVNEEHPLLSAALPTGERFQGVMPPATTAGGAFAIRKQVIKEMRLDDYRKLGSFEKVTTAGEGAL
SETDRQLCEHLDAGRIEEFIRLAVVSRYSILLSGGTSSGKTTFLNAILKEVPIEERIITIEDTREVNPIQ
KNYLPLVASKGDQGEARITVETLLQASMRLRPDRIFLGEIRGAEAYSFLRAINTGHPGSITTVHADSPAG
AFEQLALMVMQAGLGLRRDEIVSYIRSVLPIVIQQTKVGGWRGTSAVHFSRMAEWREQRTTGKGRHGARR
RL
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|337738957|ref|NC_015685.1|:c110101-109043 Oligotropha carboxidovorans OM5 plasmid pOC167, complete sequence
GTGAACGTGCTGGCGCGAAGTCTGACGGTCTTCATTGACCGCGCACTCGATCCGATCCGCACCTGGCTCG
ATGACGACCATGTCGTCGAGATTTGCGTCAACGGTCCGGCCGAGGTCTGGGTCGAGCGCTTCGGGCAGGC
CGCAATGGAGCGGCACGAGGTGCCGAGCCTAACGGAGCACGCCATCCGGCATCTTGCCGAGCGTGTCGCC
GGACATTCGGGCCAGAGCGTCAACGAGGAGCATCCGTTGCTCTCCGCGGCGCTGCCGACCGGAGAGCGCT
TTCAGGGCGTGATGCCGCCGGCGACGACGGCGGGAGGCGCGTTCGCCATCCGCAAGCAGGTCATCAAGGA
AATGCGGCTCGACGATTACCGCAAGCTCGGTTCATTCGAGAAGGTGACGACGGCGGGGGAGGGCGCGTTG
TCGGAAACCGACCGACAGCTCTGCGAGCATCTCGACGCCGGCCGCATCGAGGAGTTCATCCGGCTCGCCG
TGGTCAGCCGCTACTCGATCTTGCTCTCGGGCGGGACGAGCTCCGGAAAAACAACGTTCCTCAATGCCAT
CCTCAAGGAGGTGCCGATTGAGGAGCGCATCATCACCATCGAGGATACCCGGGAAGTTAACCCGATCCAG
AAAAACTACTTGCCGCTCGTCGCCTCCAAAGGCGATCAAGGGGAGGCCCGCATCACCGTTGAAACGCTGC
TGCAGGCTTCGATGCGGTTACGGCCCGACCGCATCTTTCTCGGCGAAATCCGTGGCGCCGAGGCCTACTC
ATTCTTGCGCGCCATCAATACCGGGCATCCGGGCAGCATCACGACCGTGCACGCCGACAGCCCTGCCGGC
GCCTTCGAGCAACTCGCCTTGATGGTGATGCAGGCCGGGCTCGGCCTGCGCCGCGACGAGATTGTCAGCT
ACATAAGGTCGGTACTGCCGATCGTCATTCAGCAGACAAAGGTCGGTGGATGGCGCGGCACATCGGCGGT
GCATTTCTCGCGCATGGCAGAATGGCGGGAACAGCGGACCACTGGGAAAGGCCGTCATGGCGCGCGTCGT
CGCCTATAG
 Primer design