SecReT4
Protein ID: 337739067
T4SS name [ID]VirB [199]
Gene symbolvirB10
Locus tagOCA5_pOC16701130
StrainOligotropha carboxidovorans OM5
Repliconplasmid pOC167 [GenBank: NC_015685] [Browse all T4SS(s) in this replicon]
Location [Strand]110064..111413 [-]
Producttype IV secretion protein VirB10
Component typeVirB10
UniProt IDB6JK51
KEGG IDoca:OCAR_7703, ocg:OCA5_pOC16701130
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.2e-61, Aligned region: 211..421
Protein Sequence: 449 a.a.     [Download]
>gi|337739067|ref|YP_004634426.1| type IV secretion protein VirB10 [Oligotropha carboxidovorans OM5]
MPTPDDYRSFELEAAAATSVARGRTALGSFLKFGVPIGALLVAAWMIYGTVARRSPTLTTPDKEEFRTTQ
FPAPSLSTPRVQTNQGTIVIPQAPAEPAPPPPPVAPPLALPAPPPPEPPLAGALPNDDEARRLAELERQR
QEEERRKWERLRAPQVIADNAAAAANTANPDDGSKAAAGPEDDPNRRFLSSVSAAGVEVSRAIKNNRIDA
LVAQGTMIRGVLETAVQSDLPGMVRAVVTENVWSFDGRRVLIPAGSRLVGEYKSGIAQGQTRVFVVWTRM
LRSDGVSVQLGSNGTDDLGRAGNAGFVDNHYLERFGSAIMLSVVGGAAQFLSAYGQNTNTIGNGSIIMTT
DPVTGIVTQTQTGVNQNQLSLQAREIAAQNVSQTLTNIAQQALRNSINIPPTIYLDQGTRIIVFVRRDLD
FSALYPDPVKEALRELKRERAGAKSDGLH
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|337738957|ref|NC_015685.1|:c111413-110064 Oligotropha carboxidovorans OM5 plasmid pOC167, complete sequence
ATGCCCACGCCTGACGACTATCGCTCGTTCGAACTGGAAGCTGCGGCGGCAACCTCCGTCGCGCGCGGTC
GAACCGCGCTCGGCAGTTTTTTGAAATTCGGGGTGCCGATCGGCGCGCTTCTTGTTGCTGCCTGGATGAT
CTATGGAACGGTCGCGCGGCGTTCGCCCACCCTAACGACGCCGGACAAAGAGGAGTTCAGGACGACGCAG
TTTCCAGCGCCGTCGCTTTCGACCCCTCGCGTGCAAACCAACCAGGGTACCATCGTCATTCCGCAGGCCC
CGGCCGAACCCGCCCCACCACCTCCCCCGGTCGCACCACCGCTTGCGTTGCCGGCGCCCCCTCCGCCGGA
GCCGCCGCTGGCGGGTGCGCTGCCGAACGACGACGAAGCGCGCCGTCTCGCGGAGCTCGAACGGCAGCGG
CAGGAGGAGGAGCGACGAAAATGGGAGCGCCTTCGGGCTCCGCAGGTCATTGCCGACAACGCCGCAGCGG
CGGCAAACACTGCAAACCCAGACGATGGCAGCAAGGCCGCCGCAGGTCCGGAGGACGATCCCAATCGTCG
CTTCCTGTCGTCGGTTTCCGCGGCCGGCGTCGAGGTTTCCCGAGCGATCAAGAACAACCGCATTGACGCG
CTGGTGGCGCAGGGGACGATGATTCGTGGTGTGTTGGAGACGGCCGTCCAGAGCGATCTGCCAGGCATGG
TGCGCGCCGTTGTCACCGAGAATGTCTGGTCGTTCGACGGTCGGCGCGTTCTCATTCCTGCTGGAAGCCG
CCTTGTCGGCGAGTACAAGTCGGGGATCGCACAAGGTCAGACGCGCGTCTTCGTGGTGTGGACCCGCATG
CTGCGCTCCGATGGCGTCTCGGTGCAGCTCGGATCGAACGGCACCGACGATCTGGGCCGCGCCGGCAATG
CCGGCTTCGTCGACAATCATTATCTGGAGCGCTTCGGTTCGGCGATCATGCTGTCGGTCGTCGGCGGCGC
AGCGCAGTTCTTGAGTGCTTATGGCCAGAACACCAACACGATCGGCAATGGCTCCATCATCATGACGACG
GATCCGGTGACAGGAATCGTGACGCAGACGCAAACGGGGGTGAACCAAAATCAGTTGAGCCTGCAGGCTC
GGGAGATCGCGGCGCAAAACGTGTCGCAGACGCTGACCAACATCGCGCAGCAGGCGCTCAGAAACTCAAT
CAATATCCCACCCACGATCTACCTCGACCAAGGAACGCGGATCATCGTCTTCGTTCGGCGCGATCTCGAT
TTTTCGGCGCTCTATCCGGATCCGGTCAAGGAAGCCTTGAGGGAGCTGAAGCGTGAACGTGCTGGCGCGA
AGTCTGACGGTCTTCATTGA
 Primer design