SecReT4
Protein ID: 337739068
T4SS name [ID]VirB [199]
Gene symbolvirB9
Locus tagOCA5_pOC16701140
StrainOligotropha carboxidovorans OM5
Repliconplasmid pOC167 [GenBank: NC_015685] [Browse all T4SS(s) in this replicon]
Location [Strand]111416..112219 [-]
Producttype IV secretion protein VirB9
Component typeVirB9
UniProt IDB6JK50
KEGG IDoca:OCAR_7702, ocg:OCA5_pOC16701140
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.3e-62, Aligned region: 31..240
Protein Sequence: 267 a.a.     [Download]
>gi|337739068|ref|YP_004634427.1| type IV secretion protein VirB9 [Oligotropha carboxidovorans OM5]
MKTRCIVLGLSFCIMASAAHAEALPRPGRTDSRVRDVVYNRDNVTAIDASYGTSTMIELQPDEKIETLAL
GDSIAWKVEPNRKGDIIFVKPVDKNAISNLNVVTDKRIYSFLLRSNTRPPSGQIYAVRFRFPDDEASAKL
LAEAKERAANPNLKDLNIANANSDYGYKGSSVNKPVAVFDDGTKTWFRFEGETPAIYIVDADRNESLVNF
RTEGPYIIVDKVSPQWTLRNGQESTCIFNRRLTNVHEPNGLEPYQPQRVGATTTVGG
 
Nucleotide Sequence: 804 bp     [Download]
>gi|337738957|ref|NC_015685.1|:c112219-111416 Oligotropha carboxidovorans OM5 plasmid pOC167, complete sequence
ATGAAAACGCGTTGTATCGTCCTCGGTTTGAGCTTCTGCATTATGGCGAGCGCCGCGCATGCGGAAGCGC
TGCCGCGTCCTGGCCGCACCGATTCCCGAGTCCGGGACGTCGTCTATAACAGGGACAACGTCACCGCGAT
CGACGCGAGTTACGGCACGTCGACGATGATCGAGCTGCAGCCGGACGAAAAAATCGAAACCTTAGCGCTC
GGCGACTCGATTGCCTGGAAGGTCGAGCCGAACCGCAAGGGCGACATCATCTTTGTCAAGCCGGTCGACA
AGAACGCGATCTCGAACCTCAACGTCGTCACCGATAAGCGTATCTATTCGTTCTTGCTGCGCTCGAACAC
GCGGCCGCCGTCCGGTCAGATCTACGCAGTGCGTTTCCGATTCCCCGACGACGAAGCGAGCGCGAAGCTT
TTGGCCGAGGCGAAGGAGCGCGCCGCCAACCCCAATCTCAAGGACCTCAACATCGCGAACGCCAACAGCG
ACTATGGCTACAAGGGCTCCTCGGTGAACAAGCCGGTCGCGGTCTTCGACGACGGGACCAAGACCTGGTT
CCGGTTCGAGGGCGAGACGCCGGCGATCTATATCGTCGACGCGGACCGCAACGAGAGCCTGGTCAATTTC
CGGACCGAGGGCCCCTACATCATCGTCGACAAGGTCTCGCCGCAGTGGACGCTTCGCAATGGCCAGGAAT
CGACGTGCATCTTCAACCGCCGCCTCACCAACGTGCATGAACCGAACGGGCTGGAGCCCTATCAGCCGCA
ACGGGTGGGCGCGACGACGACCGTGGGAGGCTGA
 Primer design