SecReT4
Protein ID: 337739069
T4SS name [ID]VirB [199]
Gene symbolvirB8
Locus tagOCA5_pOC16701150
StrainOligotropha carboxidovorans OM5
Repliconplasmid pOC167 [GenBank: NC_015685] [Browse all T4SS(s) in this replicon]
Location [Strand]112216..112932 [-]
Producttype IV secretion protein VirB8
Component typeVirB8
UniProt IDB6JK49
KEGG IDoca:OCAR_7701, ocg:OCA5_pOC16701150
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.5e-64, Aligned region: 21..226
Protein Sequence: 238 a.a.     [Download]
>gi|337739069|ref|YP_004634428.1| type IV secretion protein VirB8 [Oligotropha carboxidovorans OM5]
MTETVTSEPARVDPRYYADGATWERDIARRNRNSRALAWIVATVMSVVAVGALGTLALLVPLKTYEPYMV
VVDKTTGFVEVKRPMAEGPLTQDEAVTTFNVVRYIKARETYDPKALKDNFDLAQLLATGDAARELTEIYS
PANPNNPVKVYGTNTVVAVTIKSVTFPNNRTALARFSTEEKSSTNVITRNWVSLVRFRYTSAPMRNEWRF
DNPLGFQVLEYRRDQETAPSPGTVGAQQ
 
Nucleotide Sequence: 717 bp     [Download]
>gi|337738957|ref|NC_015685.1|:c112932-112216 Oligotropha carboxidovorans OM5 plasmid pOC167, complete sequence
ATGACGGAAACCGTGACATCAGAGCCCGCGCGCGTCGATCCGCGCTACTATGCCGACGGCGCGACATGGG
AGCGCGACATCGCGCGGCGGAATCGCAACTCCCGCGCGCTGGCCTGGATCGTCGCGACCGTGATGAGCGT
GGTCGCAGTCGGGGCGCTCGGAACACTCGCCCTGCTCGTCCCGCTCAAGACCTACGAGCCTTATATGGTC
GTTGTCGACAAGACGACCGGCTTCGTCGAGGTGAAGCGCCCGATGGCCGAAGGCCCGTTGACCCAGGACG
AAGCGGTGACGACGTTCAACGTCGTCCGTTACATCAAGGCGCGGGAAACTTATGACCCCAAGGCGTTGAA
GGACAACTTCGACCTCGCCCAGCTGCTGGCGACGGGAGACGCAGCGCGTGAGCTCACGGAAATCTACTCG
CCCGCCAATCCGAACAATCCCGTCAAGGTCTACGGCACCAACACTGTTGTCGCGGTCACAATCAAATCCG
TGACCTTCCCGAACAATCGAACCGCGCTGGCGCGGTTTTCGACCGAGGAGAAATCATCGACCAACGTCAT
TACGCGCAACTGGGTCTCGCTCGTGCGGTTCCGCTATACCTCCGCGCCGATGCGCAATGAGTGGCGCTTC
GACAATCCGCTCGGCTTCCAGGTGCTGGAATATCGCCGCGATCAGGAAACGGCGCCGTCGCCCGGAACTG
TGGGTGCGCAACAATGA
 Primer design