SecReT4
Protein ID: 337739070
T4SS name [ID]VirB [199]
Gene symbolvirB6
Locus tagOCA5_pOC16701160
StrainOligotropha carboxidovorans OM5
Repliconplasmid pOC167 [GenBank: NC_015685] [Browse all T4SS(s) in this replicon]
Location [Strand]112929..114059 [-]
Producttype IV secretion protein VirB6
Component typeVirB6
UniProt IDB6JK48
KEGG IDoca:OCAR_7700, ocg:OCA5_pOC16701160
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.6e-42, Aligned region: 46..284
Protein Sequence: 376 a.a.     [Download]
>gi|337739070|ref|YP_004634429.1| type IV secretion protein VirB6 [Oligotropha carboxidovorans OM5]
MGNTFSITTLLQSVDQLGQNYVSTAYQALASAATSGGGTGVAGLLLTLYVIFWGVGIWQGTATGGPADHA
FRLFRAMLIYTMATKWGDFQTLAYNFLNDGPSAIGNALLSAVTTANNTGTSANLNSVNGVQSALQNMWNT
TNSATEAFLQNAGITNWGPYIFAAVFYVVMAVLIGFAIFLIVLSKMFMWLLLALAPLFIILLLFGVTTRF
FSGWLSALVQYFLVQVLVYAFLAFYVSLIQQTIDTLNGVANSKSATWATIGPVVLLAIIGILLLSQINNM
AAAIAGGVPIFAPRIGAVLATATGYRLGAAANRARLAFRNPLNPASMSRREELASRQRARVGLRAASWAQ
SAEFRRLAEQLRNPGVPPASSGGGRP
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|337738957|ref|NC_015685.1|:c114059-112929 Oligotropha carboxidovorans OM5 plasmid pOC167, complete sequence
ATGGGAAACACCTTCAGTATTACGACGTTGCTGCAATCTGTCGACCAACTCGGTCAGAACTATGTCTCCA
CCGCCTACCAGGCGCTGGCGAGCGCGGCGACCTCGGGTGGCGGAACCGGCGTCGCCGGCTTGCTCCTGAC
GCTCTACGTGATTTTTTGGGGTGTCGGCATATGGCAGGGCACCGCGACAGGTGGCCCCGCCGACCATGCA
TTTCGCCTGTTTCGCGCGATGCTGATTTACACCATGGCCACGAAGTGGGGCGACTTCCAGACGCTCGCGT
ATAATTTCCTCAACGACGGTCCCTCCGCCATCGGCAACGCCCTGCTCAGCGCGGTCACCACTGCCAATAA
CACCGGAACGTCCGCAAATCTGAACTCCGTCAACGGCGTGCAGTCGGCGCTTCAGAATATGTGGAACACG
ACCAACAGCGCCACGGAGGCGTTTCTCCAAAACGCCGGCATCACCAATTGGGGGCCCTACATCTTTGCCG
CCGTGTTTTACGTCGTGATGGCAGTGCTGATCGGCTTTGCAATCTTCCTCATCGTGCTGTCGAAGATGTT
CATGTGGTTGCTGCTGGCATTGGCGCCGCTGTTCATCATTCTGCTGCTGTTCGGCGTGACGACGCGATTT
TTCAGCGGCTGGCTCAGCGCACTCGTGCAATATTTTCTCGTCCAGGTGCTGGTCTATGCGTTTCTGGCCT
TCTACGTCTCGCTGATCCAGCAGACGATCGATACGCTCAACGGCGTTGCCAATTCGAAGTCCGCGACCTG
GGCCACCATCGGACCGGTGGTGCTGCTCGCGATCATCGGCATCCTGCTGCTCAGCCAGATCAACAATATG
GCTGCGGCGATTGCCGGCGGCGTCCCGATCTTCGCGCCGCGCATCGGTGCGGTCCTCGCAACTGCAACCG
GCTATCGCCTCGGCGCGGCCGCAAACCGAGCCCGCCTTGCCTTCCGCAATCCGCTCAATCCGGCCTCGAT
GTCGCGCCGCGAGGAGCTGGCGTCGCGCCAACGCGCGCGTGTCGGTCTCCGTGCCGCCTCATGGGCGCAA
TCGGCGGAATTCCGTCGCCTCGCCGAACAGTTGCGTAACCCGGGCGTGCCGCCGGCGTCGAGTGGCGGAG
GGCGGCCATGA
 Primer design