SecReT4
Protein ID: 337739071
T4SS name [ID]VirB [199]
Gene symbol-
Locus tagOCA5_pOC16701170
StrainOligotropha carboxidovorans OM5
Repliconplasmid pOC167 [GenBank: NC_015685] [Browse all T4SS(s) in this replicon]
Location [Strand]114475..115191 [-]
Producthypothetical protein
Component typeVirB5
UniProt IDB6JK45
KEGG IDoca:OCAR_7697, ocg:OCA5_pOC16701170
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 2.3e-05, Aligned region: 23..222
Protein Sequence: 238 a.a.     [Download]
>gi|337739071|ref|YP_004634430.1| hypothetical protein OCA5_pOC16701170 [Oligotropha carboxidovorans OM5]
MRWIFVLAVLTLTFTDAPPAMAQVPVLDSANLAKAQQIATSTQQILTADQQILQFTQKTLQAVTGDRSSQ
AQGTLAQMALGGGFSMAQAPSLGSVISGGALSFAGMGSASQNIVSTLINGLQLVQTITGLVSGQTHPADT
AYKNSVNVAATLSGLINSTQSAVQQRSSAFTQGGQQIGKAQDLKGSVDQNTQVQIQTGQTINELNGVVNN
AAAAANQANLDRIAAESSAARAMKFTQQ
 
Nucleotide Sequence: 717 bp     [Download]
>gi|337738957|ref|NC_015685.1|:c115191-114475 Oligotropha carboxidovorans OM5 plasmid pOC167, complete sequence
ATGCGTTGGATATTCGTGCTCGCTGTGTTGACGCTGACTTTTACGGACGCGCCGCCGGCGATGGCGCAGG
TTCCCGTCCTCGACAGCGCGAACCTCGCCAAAGCGCAGCAGATCGCGACCAGCACCCAGCAGATCCTCAC
CGCGGATCAACAGATCCTCCAGTTCACGCAAAAGACATTGCAAGCCGTCACCGGCGATCGCTCATCGCAG
GCGCAGGGGACGCTGGCCCAGATGGCGCTCGGCGGCGGCTTCTCGATGGCGCAAGCACCGTCCCTCGGGT
CGGTGATTTCGGGCGGGGCCTTGTCGTTCGCGGGCATGGGGTCGGCGTCTCAGAACATCGTCTCGACCCT
CATTAACGGACTGCAGTTGGTGCAGACCATTACCGGCCTCGTCAGCGGTCAGACCCATCCCGCCGATACG
GCCTACAAGAACTCCGTCAATGTTGCGGCAACGCTGTCCGGACTGATCAACTCGACACAGAGCGCCGTAC
AGCAGCGATCGTCAGCGTTCACGCAAGGCGGGCAACAAATCGGCAAGGCGCAAGACCTCAAAGGCAGCGT
CGATCAGAACACCCAGGTGCAAATCCAGACCGGGCAAACCATCAACGAGCTCAACGGCGTCGTCAACAAC
GCCGCGGCCGCCGCCAATCAAGCAAACCTCGATCGCATTGCCGCGGAATCGTCCGCCGCCCGCGCGATGA
AATTCACACAGCAGTAA
 Primer design