SecReT4
Protein ID: 337739073
T4SS name [ID]VirB [199]
Gene symbolvirB4
Locus tagOCA5_pOC16701190
StrainOligotropha carboxidovorans OM5
Repliconplasmid pOC167 [GenBank: NC_015685] [Browse all T4SS(s) in this replicon]
Location [Strand]116096..118507 [-]
Producttype IV secretion protein VirB4
Component typeVirB4
UniProt IDB6JK43
KEGG IDoca:OCAR_7695, ocg:OCA5_pOC16701190
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 8.9e-42, Aligned region: 188..393
AAA_10 [PF12846], Evalue: 4.8e-35, Aligned region: 447..727
Protein Sequence: 803 a.a.     [Download]
>gi|337739073|ref|YP_004634432.1| type IV secretion protein VirB4 [Oligotropha carboxidovorans OM5]
MVARALLDELTFGAVSRRERPVASHLPYTRHVDDHIIKTRDGLVLTVLKLDGYSFETSDMSEVNARLLGR
NDVVRTLANSRFALAAHIIRREVQPRIESTFDNLLCRELDERYDAALSQRRMFVNDIYLTLIRRPLQGQA
GTFDVMLTKLLGRKDEAGGSVAAQTALTELRDAATAVRENLAGYGARQLGVVRREGLWFSEPLEFLVQLI
NGGIPRPMHLPRMNVADALSMKRIFFGRNTIEIRGAGPEDTRFGAMVSIREYPAQTGPGSFDNLLRVPHE
FIATQTFAIVDRPEAAKQIDRVSRQVDMSDEAGSIVAEHLDDARDELLASEAIYGEHHMTVMCLGRDLPE
VGAAVTAVGAALTDRSVIWTREDLNCEPAFWAQFPGNFQYIARKAVISSKNFAGFTSLHNYPSGRPDGNH
WGPAISVFETTSQTAYYYNHHVRDIGNFTVVGPTGSGKTVFLSFIAAQTQRVQPRPKLLFVDKDRGAEIF
IRALGGQYETLVPGEPTGFNPLSLPDSAPNREFLYQLFAFMLRPVNGADLTASEEQVIRNAIAAALAGGP
AGRTLKAFSTLLRGRIRAGEGDLLARLESWMRPDQRGWLFNNEEDQFSLSSVFGFDMTRVLDDPAIRTAA
LMYIFHRTEELLTGDPVMIFLDEGWRLLDDDVFAFFIRDKLKTIRKQNGIVGFGTQSAADIVRSKASNTL
IEQTSTNIFFPNPKADDESYQKAFRLSGREVAWIRGTVPESRSFLIKHGRDSVVARLNLASMPDMIKVLS
GRTETVAELDALRARVGYDPAVWLPIFMGRSQG
 
Nucleotide Sequence: 2412 bp     [Download]
>gi|337738957|ref|NC_015685.1|:c118507-116096 Oligotropha carboxidovorans OM5 plasmid pOC167, complete sequence
ATGGTCGCGCGTGCTCTGCTCGATGAACTGACCTTCGGCGCCGTCTCGCGGCGCGAGCGTCCCGTCGCAT
CGCACCTGCCCTATACGCGGCATGTCGATGACCACATCATCAAGACCCGCGACGGACTGGTTCTCACGGT
GCTCAAGCTCGATGGCTATTCGTTCGAGACCTCCGACATGAGCGAGGTCAATGCGCGCTTGCTGGGCCGC
AACGACGTGGTCCGCACGCTCGCCAATTCGCGGTTCGCGCTTGCGGCCCATATCATCCGGCGGGAGGTGC
AGCCGCGCATCGAATCGACCTTCGACAATCTGCTGTGCCGTGAACTCGACGAGCGCTACGACGCGGCGCT
GTCGCAGCGCCGCATGTTCGTCAACGACATCTATTTGACGCTCATACGGCGCCCGCTACAGGGGCAGGCT
GGCACCTTCGACGTCATGCTGACCAAGCTGCTCGGCCGCAAGGACGAGGCCGGGGGATCCGTCGCCGCGC
AAACGGCCCTGACCGAGCTTCGCGACGCCGCGACGGCGGTCCGCGAGAACCTTGCCGGATACGGCGCCCG
CCAGCTGGGCGTGGTGCGCCGGGAGGGCTTGTGGTTTTCCGAGCCGCTGGAGTTCCTGGTGCAACTCATC
AATGGCGGCATCCCTCGCCCTATGCACCTGCCGCGCATGAACGTCGCGGACGCACTGTCGATGAAGCGGA
TCTTCTTCGGCCGCAACACCATCGAAATCCGCGGCGCGGGACCCGAGGATACGCGCTTCGGCGCCATGGT
GTCGATCCGAGAATACCCAGCGCAGACCGGGCCGGGCTCGTTCGACAATCTCTTGCGTGTGCCGCACGAG
TTCATCGCGACGCAGACCTTTGCCATCGTTGATCGGCCGGAGGCGGCCAAGCAGATCGACCGGGTGTCGC
GCCAGGTCGACATGTCGGACGAGGCCGGCTCCATCGTCGCGGAACATCTCGACGACGCACGTGATGAATT
ACTCGCCTCCGAGGCGATCTATGGCGAGCACCACATGACCGTGATGTGCCTTGGTCGCGACCTGCCGGAA
GTGGGGGCGGCTGTCACAGCGGTCGGCGCGGCGCTGACCGATCGTTCGGTGATCTGGACCCGCGAGGATC
TCAATTGCGAGCCGGCGTTTTGGGCGCAGTTTCCGGGCAATTTCCAATATATCGCTCGCAAGGCCGTGAT
CTCGTCGAAGAATTTCGCGGGCTTCACCTCGCTGCACAACTATCCGAGCGGTCGGCCGGACGGCAACCAT
TGGGGGCCGGCGATCTCGGTCTTTGAGACGACCTCGCAGACGGCTTACTATTACAACCATCACGTCCGCG
ATATCGGCAACTTCACCGTCGTCGGACCGACCGGATCGGGAAAAACCGTCTTTCTGTCCTTCATCGCAGC
GCAAACGCAGCGTGTTCAGCCTCGACCGAAATTGCTGTTCGTCGACAAGGATCGCGGCGCCGAGATTTTC
ATCCGGGCGCTTGGCGGCCAGTATGAGACCTTGGTGCCGGGCGAACCGACCGGATTCAACCCGCTGTCCT
TGCCGGATAGCGCGCCCAACCGCGAATTCCTCTACCAGCTGTTCGCCTTCATGTTGCGGCCTGTGAACGG
CGCGGACCTGACCGCGTCCGAGGAGCAGGTGATCCGGAACGCGATTGCCGCGGCGCTCGCCGGCGGTCCA
GCGGGTCGCACGCTGAAAGCCTTCTCGACCCTGTTGCGCGGCCGCATCAGGGCAGGGGAGGGCGACCTGC
TGGCGCGCCTCGAGAGCTGGATGCGCCCCGACCAACGCGGCTGGCTGTTCAACAACGAGGAGGATCAGTT
CTCGTTGTCGAGTGTGTTCGGATTCGACATGACACGGGTGCTCGACGATCCGGCGATCCGCACCGCGGCG
CTAATGTATATTTTCCATAGGACAGAGGAGTTGCTCACCGGCGATCCGGTGATGATCTTCCTCGATGAAG
GCTGGCGGCTGCTCGATGACGACGTGTTCGCTTTCTTCATTCGCGACAAGCTTAAGACCATCCGCAAACA
AAACGGCATCGTCGGTTTCGGCACGCAGTCTGCCGCTGACATTGTGCGATCGAAGGCGTCGAACACGCTG
ATCGAACAGACCAGCACCAACATCTTCTTTCCCAATCCAAAAGCCGACGACGAAAGCTACCAGAAGGCTT
TTCGCCTCTCCGGACGCGAGGTCGCCTGGATCCGCGGCACGGTCCCGGAAAGTCGTTCGTTTCTGATCAA
GCATGGCCGCGACAGCGTCGTGGCCCGGCTCAACCTCGCCAGCATGCCCGACATGATCAAGGTGCTGTCA
GGGCGCACCGAGACGGTCGCCGAGCTCGACGCGTTGCGCGCGCGCGTCGGTTATGACCCGGCGGTATGGC
TGCCAATCTTCATGGGGAGAAGCCAGGGATGA
 Primer design