SecReT4
Protein ID: 337739074
T4SS name [ID]VirB [199]
Gene symbolvirB3
Locus tagOCA5_pOC16701200
StrainOligotropha carboxidovorans OM5
Repliconplasmid pOC167 [GenBank: NC_015685] [Browse all T4SS(s) in this replicon]
Location [Strand]118517..118813 [-]
Producttype IV secretion protein VirB3
Component typeVirB3
UniProt IDB6JK42
KEGG IDoca:OCAR_7694, ocg:OCA5_pOC16701200
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.9e-22, Aligned region: 8..93
Protein Sequence: 98 a.a.     [Download]
>gi|337739074|ref|YP_004634433.1| type IV secretion protein VirB3 [Oligotropha carboxidovorans OM5]
MTENELEDPLITPLVKALTRAPTLMGVPYMYFMFNGVVSSVCFLISHNLFMLLVAIPLHLFGFVMTLRDD
RIFEILFVKSTKCPPRSRAFWAADSYSA
 
Nucleotide Sequence: 297 bp     [Download]
>gi|337738957|ref|NC_015685.1|:c118813-118517 Oligotropha carboxidovorans OM5 plasmid pOC167, complete sequence
ATGACGGAGAACGAGCTCGAGGATCCGCTGATCACACCCCTCGTCAAGGCGCTGACCCGCGCCCCGACGC
TGATGGGCGTGCCGTACATGTACTTCATGTTCAATGGCGTGGTTTCGAGCGTGTGCTTTTTGATCTCGCA
CAATCTCTTCATGCTGTTGGTGGCGATCCCGTTGCACCTGTTCGGCTTCGTCATGACGCTGCGCGACGAC
CGCATCTTCGAAATCCTGTTCGTCAAATCCACCAAATGTCCGCCCCGCTCGCGCGCCTTCTGGGCCGCGG
ACAGCTACTCCGCGTGA
 Primer design