SecReT4
Protein ID: 337739075
T4SS name [ID]VirB [199]
Gene symbolvirB2
Locus tagOCA5_pOC16701210
StrainOligotropha carboxidovorans OM5
Repliconplasmid pOC167 [GenBank: NC_015685] [Browse all T4SS(s) in this replicon]
Location [Strand]118810..119112 [-]
Producttype IV secretion family protein VirB2
Component typeVirB2
UniProt IDB6JK41
KEGG IDoca:OCAR_7693, ocg:OCA5_pOC16701210
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.2e-21, Aligned region: 11..94
Protein Sequence: 100 a.a.     [Download]
>gi|337739075|ref|YP_004634434.1| type IV secretion family protein VirB2 [Oligotropha carboxidovorans OM5]
MRRSLSRWRLAGALLVMSITEAAAQSGGTLQPVQSTLTQLVQALTGPIATALATLAVIACGFFAWSGRLT
WGIAGSVIFGIVLVFGSAQIVQFFQSAVGQ
 
Nucleotide Sequence: 303 bp     [Download]
>gi|337738957|ref|NC_015685.1|:c119112-118810 Oligotropha carboxidovorans OM5 plasmid pOC167, complete sequence
ATGAGGAGATCGTTGTCGCGCTGGCGCCTTGCCGGAGCGCTGTTGGTGATGAGCATCACTGAGGCGGCGG
CGCAAAGCGGCGGCACGCTGCAGCCGGTGCAGTCGACGTTAACCCAACTCGTGCAGGCACTGACGGGGCC
GATCGCCACGGCGCTGGCGACGCTTGCCGTCATCGCCTGCGGCTTCTTCGCCTGGTCCGGCCGGCTGACC
TGGGGCATCGCCGGCAGCGTCATTTTCGGGATCGTGCTGGTGTTCGGCTCCGCGCAGATCGTCCAGTTCT
TCCAGTCGGCGGTCGGGCAATGA
 Primer design