SecReT4
Protein ID: 337739076
T4SS name [ID]VirB [199]
Gene symbol-
Locus tagOCA5_pOC16701220
StrainOligotropha carboxidovorans OM5
Repliconplasmid pOC167 [GenBank: NC_015685] [Browse all T4SS(s) in this replicon]
Location [Strand]119126..119860 [-]
Productputative lytic transglycosylase
Component typeVirB1
UniProt IDB6JK40
KEGG IDoca:OCAR_7692, ocg:OCA5_pOC16701220
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 244 a.a.     [Download]
>gi|337739076|ref|YP_004634435.1| putative lytic transglycosylase [Oligotropha carboxidovorans OM5]
MSIRISAIGFSVMAALGGAYAQDAAQPARLAAVDALGRVLPVEQPPASFERIDSTFAAVAPCAGVKAIAA
DEARALVVRIATEENFYPDFVQAVAKNESRFNSIALSDKGAFGLMQLKPETAQRFKVDLCNPADNVRGGV
RFLRALHEKYRNPFFILAAYNAGEGAVEENRGVPPFPETVRFVAQVINDFYVWPAPGNASRPGRRTAVGQ
PDLIEPDTPSAAAASPTKAAPEAHWSDGFVMHVD
 
Nucleotide Sequence: 735 bp     [Download]
>gi|337738957|ref|NC_015685.1|:c119860-119126 Oligotropha carboxidovorans OM5 plasmid pOC167, complete sequence
ATGTCGATTCGCATTTCGGCGATCGGGTTCAGCGTCATGGCGGCTCTCGGCGGCGCGTATGCGCAGGATG
CCGCCCAGCCAGCCCGCCTCGCCGCCGTCGATGCCTTGGGCAGGGTGCTTCCCGTTGAACAGCCCCCGGC
TTCGTTCGAACGCATCGACAGTACCTTTGCCGCCGTCGCTCCCTGCGCGGGCGTCAAGGCGATAGCGGCG
GACGAGGCGCGCGCTCTCGTCGTGCGCATCGCCACGGAGGAGAATTTTTATCCCGACTTCGTCCAGGCGG
TCGCCAAGAACGAAAGTCGCTTCAATTCGATCGCTCTTTCAGACAAGGGTGCATTCGGACTGATGCAGTT
GAAGCCGGAGACGGCGCAACGCTTTAAGGTCGACCTGTGCAACCCAGCCGACAACGTCCGTGGCGGCGTT
CGCTTTCTTCGCGCCCTGCACGAAAAATATCGGAATCCGTTCTTCATCCTCGCTGCCTACAACGCCGGCG
AGGGCGCGGTGGAAGAGAACCGCGGCGTCCCCCCATTCCCCGAAACGGTGCGCTTTGTGGCGCAGGTCAT
CAACGACTTCTACGTCTGGCCAGCGCCGGGCAACGCGAGCCGTCCCGGTCGGCGGACTGCTGTCGGGCAG
CCGGATCTGATTGAGCCGGACACGCCAAGCGCCGCTGCGGCTTCGCCGACCAAGGCGGCGCCGGAGGCGC
ACTGGAGCGATGGATTTGTCATGCATGTCGACTGA
 Primer design