SecReT4
Protein ID: 337739224
T4SS name [ID]Trb [243]
Gene symboltraG
Locus tagOCA5_pHCG301040
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]108113..110023 [-]
Productconjugal transfer coupling protein, VirD4 family
Component typeTraG
UniProt IDF8C167
KEGG IDocg:OCA5_pHCG301040
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.5e-146, Aligned region: 162..631
TraG-D_C [PF12696], Evalue: 6.7e-31, Aligned region: 476..597
TrwB_AAD_bind [PF10412], Evalue: 8.3e-25, Aligned region: 301..610
AAA_10 [PF12846], Evalue: 1.6e-06, Aligned region: 242..554
Protein Sequence: 636 a.a.     [Download]
>gi|337739224|ref|YP_004638504.1| conjugal transfer coupling protein, VirD4 family [Oligotropha carboxidovorans OM5]
MSANKVALSIVPSALMIGGMVALRGHEQWLASLGKTPQAALLLGRTGIALPYLGAAAIGLVFLFASAGAR
AVRAAGWGVVAGAGAVIGFAGWTEAIRLLGFVDRVRNGSVLAYTDPAMLIGGLAVAGCGLFALRVAMSGN
AAFAAAAPRRVSGPRAIHGDAQWMTINEAGRLFPDTGGIVVGERYRVDKDVAGDHAFQVRDPESWGTGGR
APLLCFDASWGSTHGIVFAGSGGYKTTSVTIPTALKWGGALVALDPSAEVAPMVIGHRRKFGRDVFVLDP
KAPEIGFNALDWIGRFGGTKEEDIASVASWIMTDVAHTHSVRDDFFRASALQLLTALIADVCLSGRTEPK
DQHLRQVRANLSEPEPKLRERLQSIYDNSTSKFVKENVASFVNMTPETFSGVYANAVKETHWLSYENYAA
LVSGNSFATDELAAGAMDVFINLDLKTLENHPGLARLIIGSLMNAIYNRAGDVAGRTLFLLDEVARLGFM
RVLETARDAGRKYGITLLMLFQSIGQMREVYGGRDAASKWFESASWMSFSAINDPETAEYISRRCGDTTV
EVSQISRSSQAAGSSRTRSRLLSRRPLILPHEITQMRSDEQIVFTAGNPPLRCGRAIYFRRKEMTASVAA
NRYQAA
 
Nucleotide Sequence: 1911 bp     [Download]
>gi|337739122|ref|NC_015689.1|:c110023-108113 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
ATGAGCGCGAATAAGGTCGCCCTGTCGATCGTGCCTTCGGCGCTGATGATCGGCGGCATGGTCGCGCTGC
GCGGTCATGAGCAATGGCTCGCAAGTTTAGGTAAGACGCCGCAGGCGGCACTCCTGCTGGGCAGAACCGG
CATCGCCCTGCCCTATCTGGGCGCGGCCGCAATCGGGTTAGTCTTCCTGTTCGCGAGCGCCGGTGCCCGC
GCCGTACGAGCTGCGGGCTGGGGTGTGGTTGCCGGCGCTGGAGCGGTCATCGGCTTTGCGGGTTGGACGG
AAGCGATCCGCCTTCTCGGGTTCGTGGACCGGGTCCGCAATGGATCGGTTCTTGCCTATACCGACCCCGC
CATGCTCATCGGCGGCCTCGCAGTTGCAGGGTGTGGACTTTTCGCGCTCCGGGTGGCCATGAGCGGCAAT
GCGGCGTTCGCCGCGGCCGCGCCACGGCGGGTCTCCGGCCCACGTGCCATCCATGGTGACGCGCAGTGGA
TGACGATTAACGAGGCAGGCCGGCTCTTTCCGGACACAGGTGGCATCGTCGTTGGGGAGCGCTATCGGGT
CGACAAGGACGTTGCCGGAGATCATGCATTTCAGGTCCGCGACCCGGAAAGCTGGGGTACAGGTGGCCGC
GCGCCGCTATTGTGTTTTGATGCGTCCTGGGGCTCGACGCACGGCATCGTTTTTGCCGGCTCGGGCGGCT
ACAAAACAACGTCCGTGACAATCCCGACCGCGCTCAAGTGGGGCGGAGCGTTGGTGGCGCTTGACCCATC
TGCCGAAGTCGCTCCGATGGTCATCGGCCATCGCCGCAAATTCGGGCGCGACGTTTTCGTGCTGGACCCC
AAGGCACCGGAAATCGGCTTCAACGCACTCGACTGGATCGGTCGGTTTGGCGGAACGAAAGAGGAGGATA
TTGCCTCGGTCGCGTCATGGATTATGACCGACGTGGCGCATACTCACTCTGTCCGGGACGATTTTTTCCG
CGCCTCGGCGCTGCAACTCCTGACGGCCCTGATTGCCGACGTCTGCCTGTCCGGTCGCACCGAACCGAAG
GATCAACACTTGCGCCAGGTCCGAGCAAATCTGTCGGAGCCCGAGCCGAAACTACGGGAGCGCCTTCAAT
CGATTTACGACAACTCCACATCGAAGTTCGTCAAAGAAAATGTCGCTTCGTTCGTCAACATGACGCCCGA
AACGTTTTCGGGCGTCTATGCCAACGCGGTCAAGGAGACGCACTGGCTTTCTTACGAGAACTATGCCGCG
CTGGTCTCCGGCAACAGTTTTGCCACCGACGAGCTCGCCGCGGGAGCGATGGACGTCTTCATCAACCTCG
ACCTGAAGACGCTGGAGAACCATCCGGGACTTGCACGGCTCATCATTGGGTCGCTGATGAACGCCATCTA
TAATCGCGCTGGCGACGTCGCCGGCCGCACGCTATTTCTGCTCGACGAGGTGGCCCGACTTGGCTTCATG
CGCGTGCTTGAGACGGCGCGAGACGCCGGACGAAAATATGGAATTACGCTTCTGATGCTGTTCCAGTCCA
TCGGCCAGATGCGCGAGGTGTATGGCGGGCGTGACGCCGCATCGAAATGGTTCGAGTCGGCCTCATGGAT
GTCATTCAGCGCAATCAACGACCCCGAAACCGCCGAATACATCTCGCGCCGCTGCGGCGATACAACGGTC
GAGGTCAGCCAGATCAGCCGTAGTTCGCAGGCAGCCGGTTCCTCTCGAACACGCTCGCGCCTGCTGTCCC
GTCGACCCCTGATCCTGCCGCACGAGATTACCCAGATGCGGAGCGACGAGCAGATCGTCTTCACTGCTGG
CAACCCGCCACTGCGGTGTGGCCGCGCCATCTACTTCCGCCGCAAGGAGATGACGGCGAGCGTCGCCGCA
AATCGCTATCAGGCGGCTTGA
 Primer design