SecReT4
Protein ID: 337739228
T4SS name [ID]Trb [243]
Gene symboltraF
Locus tagOCA5_pHCG301080
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]114057..114587 [+]
Productconjugative transfer signal peptidase TraF
Component typeTraF
UniProt IDF8C171
KEGG IDocg:OCA5_pHCG301080
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2.8e-36, Aligned region: 29..173
Protein Sequence: 176 a.a.     [Download]
>gi|337739228|ref|YP_004638508.1| conjugative transfer signal peptidase TraF [Oligotropha carboxidovorans OM5]
MRPRGAVSALGLGLGAVAGIAGLGWLGGLRVNTTPSYPLGLWQIVRTNGPIAVGDLVFICMPPGPGLALG
LDRGYLRSGLCPGGAGPLIKRVAAVGGEHIDIARSVTIDGHALAHSCIRLADAEGRALNPYSGSIVPPGH
LYLHSDYAGSYDSRYFGPVPDGGLLGLARPIATFDP
 
Nucleotide Sequence: 531 bp     [Download]
>gi|337739122|ref|NC_015689.1|:114057-114587 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
ATGAGACCTCGAGGCGCGGTGTCCGCGTTGGGACTCGGCCTGGGCGCCGTCGCCGGCATTGCCGGGCTTG
GCTGGCTGGGTGGCTTGCGCGTGAATACGACCCCGAGCTATCCCCTCGGTCTCTGGCAAATCGTTCGCAC
GAACGGCCCGATCGCGGTCGGCGACCTTGTCTTCATCTGTATGCCGCCGGGGCCCGGCCTCGCACTTGGG
CTCGACCGTGGATACCTGCGTTCCGGTCTCTGTCCTGGTGGTGCTGGACCGCTCATCAAGAGGGTCGCGG
CCGTGGGCGGTGAACACATCGATATCGCGCGATCGGTAACAATTGATGGTCACGCGCTCGCTCATTCCTG
CATCCGCCTTGCCGACGCTGAGGGGCGGGCGCTCAACCCCTATTCAGGCAGCATCGTACCCCCAGGACAT
CTGTATCTTCACTCCGACTACGCAGGCTCCTATGACTCGCGCTACTTTGGGCCGGTGCCCGACGGAGGAC
TCCTCGGTCTCGCCCGGCCAATCGCCACATTCGATCCGTGA
 Primer design