SecReT4
Protein ID: 337739230
T4SS name [ID]Trb [243]
Gene symboltraH
Locus tagOCA5_pHCG301100
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]115751..116350 [+]
Productconjugal transfer protein TraH
Component typeTrbN
UniProt IDF8C173
KEGG IDocg:OCA5_pHCG301100
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 199 a.a.     [Download]
>gi|337739230|ref|YP_004638510.1| conjugal transfer protein TraH [Oligotropha carboxidovorans OM5]
MIDAALIQQCADPSLKAAIVEKFIAAAGSADPRAIAVRAGDRVVLVPPTKTPDEALALLRRYVGHAVVRV
GLTQYPAGVGVTDPEQLTADLVDPCKNLRMGTTLFAKVYRIVVKWYGTENENAVDDAIMAWRTGTFEGIG
VFSAPDPGPTGAPQVESNKVAPSIELAKPAADQPARESDPNRAGIRVDLSGIGAAKQKD
 
Nucleotide Sequence: 600 bp     [Download]
>gi|337739122|ref|NC_015689.1|:115751-116350 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
ATGATCGATGCAGCCCTGATTCAACAATGCGCCGATCCGAGTTTGAAGGCCGCGATCGTCGAAAAGTTCA
TTGCCGCGGCGGGGTCGGCCGATCCGCGCGCGATTGCGGTGCGTGCCGGCGATCGTGTCGTACTCGTGCC
CCCGACGAAAACACCCGACGAAGCTCTTGCGCTCCTGCGCCGCTATGTTGGCCACGCCGTTGTGCGCGTC
GGTCTGACGCAATATCCAGCCGGCGTCGGCGTAACCGATCCTGAACAACTCACGGCCGATCTTGTGGATC
CCTGCAAGAACCTCCGTATGGGAACGACATTATTCGCGAAGGTCTATCGTATCGTTGTGAAATGGTATGG
CACCGAGAACGAGAATGCGGTGGATGATGCCATCATGGCCTGGCGGACCGGCACGTTCGAAGGCATCGGC
GTTTTCTCAGCTCCTGATCCCGGTCCAACCGGCGCACCGCAAGTGGAATCGAATAAGGTTGCACCCAGTA
TCGAGCTCGCAAAGCCGGCGGCGGATCAGCCGGCTCGAGAGTCCGATCCGAACCGTGCGGGAATTCGTGT
CGATCTTTCTGGGATTGGCGCCGCCAAGCAAAAGGATTGA
 Primer design