SecReT4
Protein ID: 337739235
T4SS name [ID]Trb [243]
Gene symboltrbI
Locus tagOCA5_pHCG301170
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]122601..123899 [-]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDQ6LB42
KEGG IDocg:OCA5_pHCG301170
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.3e-62, Aligned region: 241..426
Protein Sequence: 432 a.a.     [Download]
>gi|337739235|ref|YP_004638515.1| conjugal transfer protein TrbI [Oligotropha carboxidovorans OM5]
MTQSLDLNGAAPNGPKMRRLNRLPVIVAIVLAVLFFGVIFYGLSTRGLYFRGDRQADGLSSGSASTYADQ
MKRGVPNGIIDDPNATQVLQPTPPVAPERPAANPFTPARESQTQQAAMETEEAWRLRMQREQQEQFMREQ
QRQRMARYQANGAAYDSPLAINLAKLQTNVATASGPATAPASAPGVARPTGAADLYAAAMRAGLGQPVDP
NGQTNKESFINQDLKKLGYVPNSVVPQRSPYELKRGSIIPATLITGINSDLPGRITAQVSQNVFDSATGH
HLLIPQGTRLLGRYDSKVTFGQSRVLVVWTDIILPNGSTLQIGAMAGSDAEGYGGFKDQVDNHYFQIFGS
AILIAAIGAGTEMAIPRDRSAFGMENSAEYAARRSFVETFGRVAERTISKNMDVQPTLEIRPGYKFNVLV
DQDMVFPSAYRS
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|337739122|ref|NC_015689.1|:c123899-122601 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
ATGACGCAATCACTCGATTTGAATGGGGCCGCTCCGAACGGGCCAAAAATGCGACGCCTCAACCGGCTGC
CGGTGATCGTGGCGATCGTGTTGGCCGTCCTGTTCTTTGGCGTGATCTTCTACGGTTTGTCGACACGGGG
ACTCTATTTCAGGGGAGATCGCCAGGCCGACGGACTCTCGTCGGGTTCCGCTTCGACCTATGCCGACCAA
ATGAAACGTGGGGTACCGAACGGAATCATCGACGATCCCAACGCGACGCAAGTCTTGCAACCGACGCCGC
CCGTTGCACCGGAGCGGCCAGCAGCCAATCCGTTTACGCCGGCACGCGAGTCTCAAACGCAGCAGGCGGC
CATGGAGACGGAGGAAGCGTGGCGATTGCGGATGCAACGTGAGCAGCAGGAACAATTCATGCGCGAACAG
CAGCGTCAGCGTATGGCACGATATCAGGCCAATGGGGCGGCATACGATTCCCCGCTTGCGATCAATCTGG
CCAAGCTGCAAACGAACGTCGCGACGGCGTCAGGTCCCGCGACTGCGCCAGCGTCAGCGCCGGGCGTCGC
ACGCCCGACGGGCGCGGCCGACCTTTATGCGGCAGCGATGCGGGCCGGATTGGGACAACCGGTCGACCCC
AACGGCCAGACGAACAAGGAGAGCTTTATCAATCAGGACTTGAAGAAGCTCGGCTATGTTCCGAACTCGG
TCGTTCCTCAACGCTCACCTTACGAGCTCAAGCGCGGTTCGATTATTCCGGCAACTCTCATAACCGGCAT
CAACTCGGATCTTCCCGGTCGCATCACCGCGCAGGTCAGTCAGAATGTCTTCGACAGCGCGACAGGCCAT
CATCTGCTGATCCCGCAGGGAACGAGATTGCTTGGGCGCTATGATTCAAAAGTGACGTTCGGTCAAAGCC
GCGTCCTCGTGGTGTGGACGGATATCATCCTCCCGAACGGTTCTACTCTTCAGATCGGCGCGATGGCGGG
CTCCGATGCTGAAGGCTATGGCGGCTTCAAGGACCAGGTCGACAACCACTATTTCCAGATCTTCGGCTCT
GCGATCTTGATTGCCGCGATCGGCGCCGGCACCGAGATGGCTATCCCGCGCGACCGCAGCGCGTTCGGAA
TGGAGAACAGCGCAGAGTATGCTGCACGACGTTCTTTTGTGGAGACGTTCGGCCGTGTTGCCGAGCGCAC
GATCTCAAAGAACATGGATGTGCAGCCGACACTGGAGATTCGCCCCGGCTACAAATTCAACGTCCTGGTC
GATCAGGACATGGTGTTTCCAAGTGCTTACAGGAGCTAA
 Primer design