SecReT4
Protein ID: 337739236
T4SS name [ID]Trb [243]
Gene symboltrbH
Locus tagOCA5_pHCG301180
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]123912..124352 [-]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDQ6LB41
KEGG IDocg:OCA5_pHCG301180
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 8.4e-30, Aligned region: 38..143
Protein Sequence: 146 a.a.     [Download]
>gi|337739236|ref|YP_004638516.1| conjugal transfer protein TrbH [Oligotropha carboxidovorans OM5]
MSALRRLIGIATLGLQVAACTAVGGQSFMSSGSRAELSAAAADAIAGDIVSRLAERIGPGKATIVLKIDD
SPFGRALEGSLRRWGYAVATDQKADERAIALAYVVDTYDGTVLARLTTPQFALGRAYKVTATGASPSSPV
SVLERG
 
Nucleotide Sequence: 441 bp     [Download]
>gi|337739122|ref|NC_015689.1|:c124352-123912 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
GTGAGCGCACTCAGACGCCTTATCGGGATCGCAACGCTGGGCTTGCAGGTCGCGGCCTGCACGGCGGTCG
GCGGCCAGAGCTTTATGTCGAGCGGATCCCGCGCAGAGTTGTCGGCGGCCGCCGCTGACGCCATAGCTGG
CGACATTGTGAGCCGCCTGGCTGAACGTATCGGGCCGGGCAAAGCGACGATCGTGTTGAAGATCGATGAC
TCGCCGTTCGGTCGCGCGCTTGAGGGCTCACTTCGGCGTTGGGGATATGCTGTCGCGACCGATCAGAAAG
CCGACGAGCGAGCGATCGCGCTGGCCTATGTGGTTGACACCTATGACGGCACAGTCCTGGCGCGGCTGAC
GACGCCGCAGTTCGCTCTTGGCCGCGCCTATAAAGTAACGGCTACCGGCGCATCGCCGTCGAGTCCGGTG
TCCGTCCTCGAGCGCGGGTGA
 Primer design