SecReT4
Protein ID: 337739237
T4SS name [ID]Trb [243]
Gene symboltrbG
Locus tagOCA5_pHCG301190
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]124355..125191 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ6LB40
KEGG IDocg:OCA5_pHCG301190
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.5e-59, Aligned region: 63..276
Protein Sequence: 278 a.a.     [Download]
>gi|337739237|ref|YP_004638517.1| conjugal transfer protein TrbG [Oligotropha carboxidovorans OM5]
MSANGVCRSMILAGLLIGAAIGLADDASAQRMSSNEARGTQLSGRWRGAPGLVTRGPDGKVIFLFGEVQP
SVVCSPLQVCDVELQAGEVVRDVLVGDTVRWKVEPATSGAVGGQAIHLIVKPAEPNLVTSMVVTTSKRTY
HIQLKSHLTQYMARVAFEYPDENGSRWSDINARMEASVVPGANVPAEQLNFEYQLSGNASWRPTRVYSDG
QKTYIQFPSSMAGQDAPVLFAISGGENRIVNYRMKGSMMIVDYHIDRAVLISGVGWWWQEKVSIWRGG
 
Nucleotide Sequence: 837 bp     [Download]
>gi|337739122|ref|NC_015689.1|:c125191-124355 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
ATGAGTGCGAACGGTGTATGCCGATCGATGATTTTGGCAGGCTTGCTGATCGGTGCAGCAATCGGGTTGG
CTGACGATGCGTCAGCCCAACGGATGAGCTCCAATGAGGCCAGAGGCACGCAGCTTTCCGGCCGATGGCG
CGGCGCACCAGGTCTGGTGACACGCGGGCCTGATGGCAAAGTCATTTTTCTCTTTGGCGAGGTTCAACCG
TCGGTCGTCTGCTCACCGTTGCAAGTGTGTGACGTCGAGCTTCAGGCAGGCGAGGTCGTGCGGGACGTTC
TTGTCGGCGATACCGTCCGATGGAAGGTCGAACCTGCTACCTCGGGGGCTGTCGGCGGTCAGGCGATCCA
TCTGATCGTGAAGCCGGCCGAGCCGAATCTTGTTACCTCGATGGTGGTGACGACGTCAAAACGGACCTAC
CACATCCAGCTCAAGTCGCACCTGACGCAATATATGGCGCGAGTCGCTTTCGAGTATCCGGATGAAAATG
GATCGAGGTGGTCCGACATCAATGCGCGGATGGAAGCCAGCGTCGTTCCCGGAGCAAATGTCCCGGCCGA
GCAATTGAACTTTGAATACCAACTCAGTGGCAATGCGAGCTGGCGGCCGACCCGCGTCTATTCCGATGGG
CAGAAGACCTACATTCAGTTCCCTTCATCGATGGCCGGCCAGGACGCGCCGGTGCTGTTCGCCATTTCCG
GAGGTGAGAACCGCATCGTCAACTACCGGATGAAGGGTTCGATGATGATCGTCGACTATCACATCGACCG
CGCGGTGCTGATCTCCGGCGTTGGCTGGTGGTGGCAGGAAAAAGTCTCGATCTGGCGGGGAGGTTAG
 Primer design