SecReT4
Protein ID: 337739238
T4SS name [ID]Trb [243]
Gene symboltrbF
Locus tagOCA5_pHCG301200
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]125215..125877 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDF8C181
KEGG IDocg:OCA5_pHCG301200
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.9e-41, Aligned region: 13..218
Protein Sequence: 220 a.a.     [Download]
>gi|337739238|ref|YP_004638518.1| conjugal transfer protein TrbF [Oligotropha carboxidovorans OM5]
MSPHSIPENPYLAARQEWNERYGSYVKAAAAWRLVGLTSLVLAVLGTAYGLYQSTQVKLVPYIIEVDKLG
NAVNAGYPQQIDYADPRVVRATLGAFVANFRSVSPDTVVQKQYIDRTYALLRTADPATEKINSWYRENSP
FVKARAATIAIEVNNVVALSNQSYQIDWTEFERDRRGKEIATRRFRGVATVTLTPPQDEQTIRFNPIGLY
LRDFDWTAQL
 
Nucleotide Sequence: 663 bp     [Download]
>gi|337739122|ref|NC_015689.1|:c125877-125215 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
ATGTCGCCGCATTCGATACCTGAGAATCCATACCTTGCTGCACGGCAGGAGTGGAACGAACGTTACGGCT
CTTATGTGAAGGCAGCCGCCGCATGGCGGCTTGTCGGACTCACGAGTTTAGTCTTGGCCGTCCTTGGAAC
CGCTTATGGCCTGTATCAAAGCACGCAGGTGAAGCTGGTCCCTTATATTATCGAGGTTGATAAGCTGGGG
AACGCGGTTAATGCCGGCTATCCGCAGCAGATCGACTACGCCGATCCGCGGGTAGTGCGCGCGACACTTG
GCGCCTTCGTCGCCAATTTCCGGTCGGTCTCGCCTGATACCGTCGTCCAGAAGCAATACATCGATCGCAC
CTACGCGTTGCTCCGCACCGCCGATCCCGCCACTGAAAAGATCAACTCCTGGTATCGCGAAAACTCCCCG
TTCGTGAAGGCTCGTGCGGCGACGATTGCCATCGAAGTCAACAACGTCGTCGCGTTGTCGAACCAAAGCT
ATCAAATCGATTGGACCGAGTTTGAGCGCGATCGACGCGGCAAGGAGATTGCGACACGTCGCTTTCGTGG
AGTGGCCACTGTGACACTGACCCCGCCGCAGGATGAGCAAACCATTCGTTTCAATCCCATCGGGCTTTAC
CTGCGCGATTTCGATTGGACGGCGCAACTATGA
 Primer design