SecReT4
Protein ID: 337739239
T4SS name [ID]Trb [243]
Gene symboltrbL
Locus tagOCA5_pHCG301210
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]125895..127091 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDF8C182
KEGG IDocg:OCA5_pHCG301210
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.8e-31, Aligned region: 62..274
Protein Sequence: 398 a.a.     [Download]
>gi|337739239|ref|YP_004638519.1| conjugal transfer protein TrbL [Oligotropha carboxidovorans OM5]
MLTHDRGGIPVVILVLMLLATPALAQDGSVLTTLENQVVTAAKGWESTVMQAARSLFWILAAIEIGVAAI
WLALQAASLDSWFAELVRRILFIGLFAFILDRGPSFAKAIVNSLFQIGAGGGDASPANVFNAGLKVASAM
SEKAKFGLFEDNALAIAAVLAMVVVVVAFSLVAAIFVSVMVEMYVGLLAGMIMLGLGGSSFTKDFTIRYL
VYAFSVGMKLMALVMIARIGSEVLLGLANEPSSGDQYLKTLAIAGISVVVFMVSMYVPSIIQGVVQGVSV
TGGMEVLRAGGQVASFAGGAASMAAGAASLGAGAARAGASSFGDARNAGSSFGAAALKGMGEGIAAAGSS
LASAARDKAIGIPGTWGASTLGLANAKLSERRNQTPSGQRQNNVDERQ
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|337739122|ref|NC_015689.1|:c127091-125895 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
ATGTTGACTCACGATCGAGGCGGTATCCCGGTCGTCATCCTTGTGCTGATGCTGCTGGCGACGCCGGCGT
TGGCGCAGGACGGCAGCGTTCTGACGACGTTGGAGAACCAGGTCGTGACCGCGGCGAAGGGCTGGGAATC
CACGGTGATGCAGGCGGCGCGGTCGCTGTTCTGGATTCTCGCGGCCATCGAGATCGGCGTTGCGGCGATC
TGGCTGGCGCTACAAGCCGCCTCGCTCGACAGTTGGTTCGCCGAGCTCGTGCGCCGCATCCTTTTTATCG
GCCTTTTCGCCTTTATCCTCGACCGTGGCCCAAGTTTCGCAAAGGCTATCGTCAACAGCCTTTTCCAGAT
TGGCGCCGGTGGCGGTGATGCCTCGCCGGCGAACGTTTTCAATGCGGGCCTGAAGGTCGCTTCCGCAATG
TCGGAAAAGGCGAAGTTCGGTTTGTTCGAGGATAATGCGCTGGCGATCGCGGCGGTGTTGGCGATGGTCG
TCGTTGTCGTCGCATTCTCACTGGTCGCCGCCATCTTCGTCTCTGTGATGGTGGAAATGTATGTTGGGCT
GCTCGCTGGCATGATCATGCTTGGCCTCGGCGGCTCGTCCTTCACCAAGGATTTCACTATCCGCTATCTT
GTCTACGCCTTCAGCGTCGGCATGAAGCTGATGGCCTTGGTGATGATCGCGCGCATTGGCTCGGAGGTGC
TACTGGGCCTCGCCAATGAGCCGTCGAGCGGCGATCAATATCTCAAGACCCTGGCCATCGCGGGCATCTC
CGTCGTCGTCTTTATGGTGTCGATGTACGTTCCGAGCATCATTCAGGGCGTTGTCCAGGGAGTATCAGTC
ACGGGTGGCATGGAGGTGCTGCGCGCCGGCGGTCAGGTCGCGTCGTTTGCGGGTGGGGCGGCCTCGATGG
CCGCAGGCGCGGCATCTCTTGGCGCCGGTGCGGCGCGTGCCGGCGCATCCAGTTTTGGTGACGCGCGCAA
CGCCGGCAGTTCGTTCGGCGCGGCTGCGCTGAAGGGGATGGGTGAGGGCATCGCGGCGGCGGGCTCTTCG
CTTGCATCAGCGGCACGCGACAAGGCAATTGGGATTCCGGGGACGTGGGGCGCGTCCACGCTTGGTTTGG
CCAATGCGAAGCTTTCCGAGCGGCGTAACCAGACGCCATCCGGGCAACGTCAAAACAACGTGGATGAGCG
TCAATAA
 Primer design