SecReT4
Protein ID: 337739241
T4SS name [ID]Trb [243]
Gene symboltrbJ
Locus tagOCA5_pHCG301230
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]127277..128080 [-]
ProductP-type conjugative transfer protein TrbJ
Component typeTrbJ
UniProt IDF8C184
KEGG IDocg:OCA5_pHCG301230
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 267 a.a.     [Download]
>gi|337739241|ref|YP_004638521.1| P-type conjugative transfer protein TrbJ [Oligotropha carboxidovorans OM5]
MPTRFFPRRRAIAVVICCLVTAGPASAGGGGALTGGATEWTQILNNTELVGLVGQSTQQINNQITQITQL
AQQIQNQLRIYENMLQNTARLPTQIWGQVENDLNRLRNIVGQGQGIAFSMGNVDDVLKQRFKSYSDFKTN
LPNGSTFSSTWQNWSTTNRDTIGASLKAAGLTSDQFTTEEATMSQLRGMSQSADGQMKALQVGHQIAAQQ
VAQMQKLRGLFAQQVTMMGTWFHSKQAEQDLAQARRDGFFTSTAPSTSGGQRMEPRW
 
Nucleotide Sequence: 804 bp     [Download]
>gi|337739122|ref|NC_015689.1|:c128080-127277 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
ATGCCGACACGCTTCTTTCCGCGTAGGCGCGCAATTGCCGTGGTGATCTGCTGCCTTGTCACCGCCGGGC
CTGCGTCAGCGGGTGGCGGTGGCGCTTTGACCGGCGGGGCTACTGAATGGACTCAAATCCTCAACAACAC
CGAATTGGTCGGTCTCGTCGGTCAATCGACACAGCAGATCAACAACCAGATCACCCAGATCACGCAGCTT
GCGCAGCAGATCCAGAACCAGCTCCGCATCTACGAGAACATGCTGCAGAATACTGCGCGGCTGCCGACCC
AAATTTGGGGGCAGGTCGAGAACGATCTTAACCGGCTCCGCAACATCGTCGGGCAGGGACAGGGCATCGC
GTTTTCGATGGGGAACGTCGACGACGTCCTGAAGCAACGCTTCAAGAGCTACTCCGACTTCAAGACGAAC
CTGCCGAATGGCTCGACGTTCTCCTCAACCTGGCAGAACTGGTCGACAACGAACCGTGACACCATCGGCG
CCAGCCTGAAGGCGGCGGGCCTCACTTCGGATCAGTTTACAACAGAAGAAGCGACGATGAGCCAGTTGCG
CGGCATGTCGCAGAGCGCAGACGGTCAGATGAAGGCGCTTCAGGTCGGACACCAGATCGCTGCTCAACAA
GTCGCTCAGATGCAGAAATTGCGTGGACTGTTCGCGCAACAGGTCACGATGATGGGGACTTGGTTTCACT
CCAAACAGGCGGAACAAGATCTTGCGCAAGCGCGGCGCGACGGCTTCTTTACCTCCACCGCGCCGTCGAC
AAGCGGCGGACAAAGAATGGAGCCGCGCTGGTGA
 Primer design