SecReT4
Protein ID: 337739242
T4SS name [ID]Trb [243]
Gene symboltrbE
Locus tagOCA5_pHCG301240
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]128055..130493 [-]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDQ6LB36
KEGG IDocg:OCA5_pHCG301240
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 7.8e-47, Aligned region: 193..400
AAA_10 [PF12846], Evalue: 4.2e-36, Aligned region: 457..719
Protein Sequence: 812 a.a.     [Download]
>gi|337739242|ref|YP_004638522.1| conjugal transfer protein TrbE [Oligotropha carboxidovorans OM5]
MVALRQFRHVDPSFTDLLPYAGLVAPGIILLKDGSLMAGWYFAGPDSESSTDVERNEVSRLINAVLSRLG
SGWMIQVEAVRVPARAYPARSDCHFPDAVTRAIDDERRRRFEAESGHFESQHAMILTYRPPERRKSGLAR
YVYSDDESRSTSFADTTLAFFQTSIREVEQYLANVLSVRRMQTQEVADEGSVRRARYDELFQFIRFSITG
ENHPIRLPEIPMYLDFLVTAEFHHGLSPVVDDRYLAVVGIDGFPAESWPGILNGLDLMPLTYRWSSRFMF
LDDQEARARLERTRKKWQQKVRPFFDQLFQTQSRALDQDAMLMVAETEDAIGQASSGLVAYGYYTTVIVL
FDTDERRLRDKAEAVRRLVQAEGFGARIETLNATEAYLGSLPGNWYTNIREPLISTRNLADLIPLNAVWS
GSQTAPCPFYPPNSPPLMQVASGSTPFRMNLHVDDVGHTLVFGPTGSGKSTLLALIAAQFRRYAGAQLFC
FDKGRSMFPLTIAAGGDHYDVGGGEGLSFCPLAELKDDSDRAWAAEWIETLVALQGVKITPDHRNAITHQ
IALMAAARGRSISDFVSGVQFREIKDALHPYTVDGPMGHLLDAEQDGLLMSDFQTFEIETLMNMGERNLV
PVLLYLFRRIEKRLTGAPSLIILDEAWLMLGHPTFRDKIREWLKVLRKANCAVLLATQSISDAERSGIID
VLKESCPTKICLPNGAARETGTRDFYERIGFNERQIEIVATAIPKREYYVASPVGRRLFDMALGPITLSF
VGATGKDDLTRIAELRQQHGADWPARWLQARGVADADTLLSA
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|337739122|ref|NC_015689.1|:c130493-128055 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
ATGGTGGCGTTGCGTCAGTTTAGACATGTCGACCCCTCCTTCACGGACCTGCTTCCGTATGCGGGCCTGG
TCGCACCGGGGATCATTCTATTGAAAGACGGCTCGCTCATGGCGGGCTGGTATTTTGCGGGGCCTGACAG
CGAAAGCTCCACCGACGTCGAGCGCAACGAGGTGTCTCGTTTGATCAATGCCGTTCTGTCACGGCTAGGT
TCCGGCTGGATGATCCAGGTGGAGGCCGTGCGTGTGCCGGCGCGAGCCTATCCCGCGCGATCAGACTGCC
ATTTTCCGGACGCCGTGACCCGCGCGATCGATGATGAACGGCGCCGACGCTTCGAAGCGGAAAGCGGGCA
TTTCGAATCTCAGCACGCGATGATCCTGACCTACCGACCACCCGAACGCCGCAAGTCCGGCCTCGCACGC
TATGTGTATTCCGACGACGAAAGTCGATCGACATCGTTTGCCGACACCACACTCGCTTTCTTTCAGACCT
CGATCCGCGAGGTTGAGCAATATCTCGCCAACGTACTCTCGGTTCGCCGCATGCAGACACAGGAGGTCGC
GGACGAGGGGAGCGTGCGCCGCGCACGCTACGATGAGCTCTTCCAATTCATCCGCTTCAGCATCACCGGC
GAAAATCATCCGATCCGGTTGCCTGAGATTCCGATGTATCTGGATTTTCTCGTGACCGCCGAGTTCCACC
ATGGACTGTCGCCTGTCGTGGATGATCGCTATCTGGCGGTCGTAGGCATCGACGGATTCCCCGCGGAGAG
CTGGCCCGGCATCCTCAATGGTCTCGACCTCATGCCGCTGACCTATCGCTGGTCGAGCCGCTTCATGTTT
CTCGACGACCAGGAGGCACGGGCTCGCCTCGAGCGTACACGGAAGAAATGGCAGCAGAAGGTACGGCCCT
TCTTCGATCAGCTTTTCCAAACCCAAAGCCGTGCGCTCGATCAGGACGCCATGTTGATGGTGGCCGAAAC
GGAGGATGCGATCGGTCAAGCCTCCTCTGGTCTCGTTGCCTACGGATACTACACGACTGTGATCGTGCTG
TTCGACACAGACGAACGCCGTCTCCGTGATAAAGCGGAAGCCGTCCGTCGGCTCGTCCAGGCGGAAGGCT
TTGGAGCACGCATTGAGACCTTGAACGCAACCGAGGCCTATCTCGGCTCGTTGCCGGGAAACTGGTACAC
GAACATCCGCGAACCGCTCATCAGCACCCGCAATCTCGCCGACCTCATCCCTCTTAATGCGGTGTGGTCC
GGCAGCCAAACCGCACCCTGTCCGTTCTATCCGCCGAACTCGCCGCCGCTGATGCAGGTCGCCTCCGGAT
CGACCCCTTTCCGGATGAATCTCCACGTCGACGACGTCGGTCACACACTGGTGTTCGGCCCGACAGGCTC
CGGCAAGTCGACTTTGCTTGCACTCATCGCGGCGCAGTTTCGACGTTACGCTGGCGCTCAGCTCTTTTGT
TTCGACAAGGGCCGTTCGATGTTTCCGCTGACGATCGCCGCCGGCGGAGATCACTACGACGTGGGCGGAG
GCGAAGGTCTGTCTTTCTGTCCACTCGCCGAACTCAAGGACGACTCCGATCGCGCCTGGGCGGCCGAATG
GATCGAGACGCTGGTGGCGCTGCAGGGCGTCAAGATTACGCCGGATCATCGCAACGCGATCACGCATCAG
ATCGCCTTAATGGCAGCGGCGCGCGGACGCTCGATCTCTGATTTTGTATCGGGCGTGCAGTTTCGCGAGA
TAAAGGACGCGCTTCACCCCTACACGGTCGATGGCCCGATGGGCCACCTGCTCGATGCAGAGCAGGACGG
CCTGTTGATGTCCGATTTTCAAACGTTCGAGATTGAAACGCTCATGAACATGGGCGAACGGAATCTTGTA
CCAGTGTTGCTGTATCTGTTCCGCCGCATCGAGAAGCGGCTGACCGGCGCACCCAGCCTCATTATCCTTG
ACGAGGCGTGGCTGATGCTCGGACACCCGACCTTCCGCGACAAGATCCGCGAATGGCTCAAGGTGCTGCG
CAAAGCCAATTGCGCAGTGCTGCTCGCCACTCAATCGATCTCTGACGCCGAGCGTTCGGGAATCATCGAC
GTGCTCAAGGAATCGTGTCCGACGAAGATCTGCCTGCCGAACGGCGCAGCCCGCGAGACTGGCACGCGCG
ATTTCTACGAGCGCATCGGTTTCAATGAACGCCAGATCGAAATTGTCGCGACCGCAATACCGAAGCGTGA
GTACTACGTAGCCTCACCCGTCGGCCGGCGGCTTTTCGATATGGCCTTGGGGCCGATCACGCTGTCGTTT
GTTGGCGCGACGGGCAAGGACGACCTCACTCGGATCGCCGAGCTGCGTCAGCAGCATGGCGCGGACTGGC
CCGCACGATGGCTTCAAGCAAGGGGAGTGGCCGATGCCGACACGCTTCTTTCCGCGTAG
 Primer design