SecReT4
Protein ID: 337739243
T4SS name [ID]Trb [243]
Gene symboltrbD
Locus tagOCA5_pHCG301250
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]130502..130801 [-]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDQ6LB35
KEGG IDocg:OCA5_pHCG301250
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.7e-27, Aligned region: 1..91
Protein Sequence: 99 a.a.     [Download]
>gi|337739243|ref|YP_004638523.1| conjugal transfer protein TrbD [Oligotropha carboxidovorans OM5]
MAEGLSGLHRSRIHRALSRPNLLLGADRELVLVTGLAAVILIFVVLTWFSALLGLAIWSGIVGLLRMMAK
ADPMMRQVYLRHIRYRPRYRPTSTPWRKY
 
Nucleotide Sequence: 300 bp     [Download]
>gi|337739122|ref|NC_015689.1|:c130801-130502 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
ATGGCTGAGGGCTTATCCGGTCTGCATCGCTCGCGCATCCACCGCGCGCTGTCGCGTCCGAACCTGCTGC
TCGGCGCCGATCGCGAGCTTGTCCTGGTGACGGGGCTCGCCGCTGTGATCCTAATTTTCGTGGTGCTGAC
CTGGTTCTCAGCCTTGCTCGGTCTTGCGATCTGGAGCGGCATCGTCGGCCTGCTGCGGATGATGGCAAAG
GCCGACCCAATGATGCGTCAGGTATATCTGCGCCACATCCGCTATCGGCCGCGCTATCGCCCGACCTCGA
CGCCCTGGCGCAAATATTGA
 Primer design