SecReT4
Protein ID: 337739244
T4SS name [ID]Trb [243]
Gene symboltrbC
Locus tagOCA5_pHCG301260
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]130794..131159 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ6LB34
KEGG IDocg:OCA5_pHCG301260
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.5e-21, Aligned region: 4..98
Protein Sequence: 121 a.a.     [Download]
>gi|337739244|ref|YP_004638524.1| conjugal transfer protein TrbC [Oligotropha carboxidovorans OM5]
MSLERRLALGFVTCAALVMATHPAIAGGGGGLPWEGPLQQIQQSITGPVAGFIALAAVAVAGGMLIFGGE
LNDFARRLMYVVLVAGILLGATQIVGLFGASGASIGIDPTEASSSESVPHG
 
Nucleotide Sequence: 366 bp     [Download]
>gi|337739122|ref|NC_015689.1|:c131159-130794 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
GTGTCGCTTGAGCGTCGCCTTGCGCTTGGCTTTGTTACATGCGCCGCGTTGGTCATGGCAACGCACCCCG
CGATTGCGGGCGGGGGAGGGGGCCTGCCATGGGAAGGCCCATTACAACAGATCCAGCAATCGATCACTGG
TCCCGTCGCCGGCTTCATCGCGCTGGCGGCCGTCGCTGTCGCCGGCGGAATGCTGATCTTTGGCGGAGAG
CTGAACGACTTCGCCCGGCGGCTGATGTATGTGGTCCTCGTCGCCGGCATTCTGCTTGGTGCGACACAGA
TCGTCGGTCTGTTCGGCGCGTCTGGCGCGTCGATCGGGATTGATCCCACTGAGGCCAGCAGTTCGGAGAG
CGTCCCGCATGGCTGA
 Primer design