SecReT4
Protein ID: 337739245
T4SS name [ID]Trb [243]
Gene symboltrbB
Locus tagOCA5_pHCG301270
StrainOligotropha carboxidovorans OM5
Repliconplasmid pHCG3 [GenBank: NC_015689] [Browse all T4SS(s) in this replicon]
Location [Strand]131149..132111 [-]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDF8C0W4
KEGG IDocg:OCA5_pHCG301270
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.8e-87, Aligned region: 20..286
AAA_30 [PF13604], Evalue: 1.8e-06, Aligned region: 129..201
FtsK_SpoIIIE [PF01580], Evalue: 3.6e-06, Aligned region: 136..191
AAA_19 [PF13245], Evalue: 3.8e-06, Aligned region: 136..183
DEAD [PF00270], Evalue: 3.6e-05, Aligned region: 129..186
AAA_16 [PF13191], Evalue: 6.1e-05, Aligned region: 131..170
Protein Sequence: 320 a.a.     [Download]
>gi|337739245|ref|YP_004638525.1| P-type conjugative transfer ATPase TrbB [Oligotropha carboxidovorans OM5]
MQLRSHPRLVRKLQEAFGDTICAALDDPSVVEVMCNPDGQLFVERLGQGVTRVGEMSSAAAEIIIGSVAH
ALNSEVDDERPIVSGELPIGAHRFEGLLPPVVSAPAFAIRRRASRVIPLAAYVRDRIMTERQARMIRHAV
SSRMNIVVSGGTGTGKTTLTNAVIAEMVASTPEHRVVILEDTTELQCVAENAVALHTTDTVDMARLLKST
MRLRPDRIIVGEVRDGAALTLLKAWNTGHPGGITTIHANSAQSALTRLEQLTAEASQQPMQAVIGEAVDL
IVSIEKTARSRVVRDILQVEGFAHGEYRFQSCTEEEQRVA
 
Nucleotide Sequence: 963 bp     [Download]
>gi|337739122|ref|NC_015689.1|:c132111-131149 Oligotropha carboxidovorans OM5 plasmid pHCG3, complete sequence
GTGCAACTTCGCTCCCACCCCCGGCTCGTTCGCAAGCTCCAGGAGGCGTTCGGCGATACGATCTGCGCGG
CGCTCGATGATCCGAGCGTCGTCGAGGTCATGTGCAATCCCGACGGGCAACTTTTTGTCGAACGGCTCGG
CCAAGGCGTCACGCGGGTCGGCGAGATGAGCAGCGCCGCGGCCGAGATCATCATCGGCAGTGTCGCCCAT
GCCCTGAACTCCGAGGTCGACGACGAGCGTCCCATTGTCTCGGGTGAGCTCCCGATCGGCGCGCACCGCT
TCGAAGGCCTATTGCCGCCCGTGGTCTCAGCGCCGGCCTTTGCGATCAGACGGCGCGCCTCGCGGGTGAT
TCCGCTCGCTGCTTATGTCCGCGACCGCATCATGACGGAGCGCCAAGCTCGTATGATCCGCCACGCGGTA
TCATCGCGGATGAACATAGTCGTCTCTGGTGGCACCGGCACTGGCAAAACCACGCTGACCAACGCCGTTA
TCGCTGAAATGGTCGCATCCACGCCCGAACACCGCGTCGTCATTCTCGAGGACACAACCGAGCTGCAGTG
CGTCGCAGAGAATGCTGTCGCATTGCACACGACCGATACCGTCGACATGGCGCGGCTGCTGAAATCGACG
ATGAGGCTTCGCCCGGATCGCATCATCGTCGGCGAGGTACGCGACGGCGCCGCGCTCACGCTGCTAAAGG
CGTGGAATACAGGCCATCCCGGTGGCATCACGACGATCCATGCCAATTCGGCGCAATCGGCACTGACGCG
ACTCGAGCAGCTGACTGCCGAGGCGAGCCAGCAACCGATGCAGGCGGTGATCGGCGAAGCCGTGGATCTC
ATCGTCTCCATCGAAAAGACAGCGCGCAGTCGCGTCGTGCGCGACATTCTTCAGGTCGAGGGCTTCGCCC
ACGGCGAATATCGTTTTCAATCCTGCACGGAGGAGGAGCAACGTGTCGCTTGA
 Primer design