SecReT4
Protein ID: 337739565
T4SS name [ID]Trb [346]
Gene symboltrbC
Locus tagOCA5_c03230
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_015684] [Browse all T4SS(s) in this replicon]
Location [Strand]330990..331322 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB6JA74
KEGG IDoca:OCAR_4191, ocg:OCA5_c03230
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.1e-24, Aligned region: 10..100
Protein Sequence: 110 a.a.     [Download]
>gi|337739565|ref|YP_004631293.1| conjugal transfer protein TrbC [Oligotropha carboxidovorans OM5]
MIRTFARGCHTMATAAAAVSISVLFTQAAHASGSSMPWEAPLQSILQSIEGPVAKIIAVIIIIVTGLTLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGAVI
 
Nucleotide Sequence: 333 bp     [Download]
>gi|337739247|ref|NC_015684.1|:330990-331322 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGATCCGCACCTTCGCGCGCGGCTGCCACACCATGGCGACCGCCGCTGCCGCTGTTTCCATCAGCGTGC
TTTTCACCCAGGCCGCTCACGCCTCCGGCTCCTCGATGCCGTGGGAAGCGCCGCTGCAATCCATCCTCCA
ATCGATCGAGGGGCCGGTGGCGAAGATCATCGCCGTGATCATCATCATCGTCACCGGTCTGACGCTGGCA
TTCGGCGACACCTCAGGCGGATTCCGCCGCCTGATCCAGATCGTCTTCGGCCTGTCGATCGCGTTCGCGG
CGTCGAGCTTCTTCCTGTCCTTCTTCTCGTTCGGCGGCGGGGCGGTGATCTGA
 Primer design