SecReT4
Protein ID: 337739569
T4SS name [ID]Trb [346]
Gene symboltrbL1
Locus tagOCA5_c03270
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_015684] [Browse all T4SS(s) in this replicon]
Location [Strand]335139..336503 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB6JA69
KEGG IDoca:OCAR_4186, ocg:OCA5_c03270
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2e-54, Aligned region: 37..262
Protein Sequence: 454 a.a.     [Download]
>gi|337739569|ref|YP_004631297.1| conjugal transfer protein TrbL [Oligotropha carboxidovorans OM5]
MGGAGVIDNFLEVFTSYINSGFGLLGGEVAFIATTLIVIDVTLAALFWSWSADDDIIARLVKKTLFVGIF
AYLIGNWNNLAKIIFDSFAGLGLKASGTGFTAQDLMRPGKVAQTGLDAARPLLESISDLMGWISFFENFI
QIACLLFAWALVILAFFILAIQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVL
AVIVGIGSTLFSRFTAGFGGATPTIDDAMAVVLAALSLLGLGIFGPGIAAGLVSGGPQLGAGAAVGTGLA
VGGAALAAGGAAGLAVKGGAAAMSGGAAAMRGGASAAGGAAAAYSLGSLGQSGAAGVASGLGGVARAAGA
ATVSPLKRATLRAAESMKSSFSDGAKAGFGATGGTSTMGTIGGSADASGSSPASASRDGPPDWAKRMQRH
RSLGHGATLAAHAVRSGDSHGGGSSINLSESDRS
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|337739247|ref|NC_015684.1|:335139-336503 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGGGCGGCGCAGGCGTCATCGACAATTTCCTCGAGGTCTTCACCTCCTACATCAACAGCGGCTTCGGAC
TGCTCGGCGGCGAAGTGGCGTTTATCGCCACCACCCTGATCGTCATTGATGTCACGCTCGCGGCGCTGTT
CTGGAGCTGGAGCGCCGACGACGACATCATCGCGCGACTGGTCAAGAAGACGCTGTTCGTCGGGATCTTC
GCTTACCTCATCGGCAACTGGAACAATCTCGCCAAGATCATCTTCGACTCCTTCGCCGGGCTCGGCCTCA
AAGCCTCCGGCACCGGCTTCACCGCGCAGGATCTCATGCGGCCCGGCAAGGTCGCGCAGACTGGTCTCGA
TGCGGCGCGGCCGCTCCTGGAATCCATCTCCGACCTGATGGGTTGGATCAGCTTCTTCGAGAACTTCATC
CAGATCGCTTGCCTGCTCTTCGCCTGGGCGCTGGTCATTCTCGCCTTCTTCATCCTCGCCATCCAGCTCT
TCGTCACCCTGATCGAATTCAAGCTGACGACGCTCGCTGGTTTCGTCCTCATTCCCTTTGGTCTCTTTGG
CAAGACCGCATTCATGGCTGAACGCGTTCTCGGCAACGTCGTATCGAGCGGCATCAAGGTTCTCGTTCTG
GCCGTCATCGTCGGCATTGGATCGACTCTGTTCAGCCGCTTTACCGCAGGTTTCGGCGGCGCGACGCCGA
CCATCGATGACGCCATGGCCGTCGTCCTCGCGGCCCTGTCCCTTCTCGGCCTTGGCATCTTCGGCCCAGG
GATCGCGGCTGGCCTCGTCAGCGGAGGACCTCAGCTCGGCGCCGGCGCTGCCGTTGGAACAGGCCTTGCC
GTCGGCGGCGCGGCGCTCGCCGCCGGAGGCGCCGCTGGTCTTGCCGTGAAGGGAGGCGCAGCCGCCATGT
CGGGCGGGGCCGCCGCGATGCGTGGCGGCGCATCGGCCGCCGGTGGCGCCGCCGCCGCCTACAGCCTCGG
CTCGCTCGGTCAGTCTGGCGCCGCAGGAGTCGCCTCGGGCCTCGGCGGTGTCGCCCGCGCCGCTGGCGCT
GCAACGGTCTCGCCGTTGAAGCGTGCGACCTTGCGTGCGGCCGAAAGCATGAAGTCCAGCTTCTCGGACG
GCGCGAAGGCAGGCTTCGGCGCCACCGGCGGCACATCGACGATGGGCACCATCGGCGGCTCCGCCGATGC
GTCCGGTTCCTCTCCCGCCTCGGCGTCTCGAGACGGCCCGCCTGATTGGGCCAAGCGCATGCAGCGCCAT
CGTTCTCTCGGACACGGCGCCACCCTCGCAGCACATGCCGTTCGCTCAGGCGACAGCCACGGCGGGGGCT
CCTCCATCAATCTTTCTGAAAGTGACCGCTCATGA
 Primer design