SecReT4
Protein ID: 337739571
T4SS name [ID]Trb [346]
Gene symboltrbG1
Locus tagOCA5_c03290
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_015684] [Browse all T4SS(s) in this replicon]
Location [Strand]337186..338169 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDB6JA67
KEGG IDoca:OCAR_4184, ocg:OCA5_c03290
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.6e-62, Aligned region: 104..320
Protein Sequence: 327 a.a.     [Download]
>gi|337739571|ref|YP_004631299.1| conjugal transfer protein TrbG [Oligotropha carboxidovorans OM5]
MNPSFRRSAFPVFRKSAFAAALLSATVLAGCATAPKPPQISYDSTVPPLPSVPAVITDQRPRPLHTPPAW
IPARGGNSASTPTARVENANAAARVEPRRDGYYNSIQIYPWSEGALYQVYAAPGQITNIALEPGENLTGA
GPIAAGDTARWIIGDTESGSGVTRRVHVLVKPTRTDITTNLVITTDRRVYMIELRAGTNPYMPAVAWAYP
EPPASQRANVPARPVVPAATARNYRYGLMGDTPPWRPVSVYDDGRRVYVEFPRGIVQGEMPPIFVIGSDG
EPQIVNSRIYQNILIVDRIFGAAELRLGGGDRQQTVRIVRTDGRPAS
 
Nucleotide Sequence: 984 bp     [Download]
>gi|337739247|ref|NC_015684.1|:337186-338169 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGAACCCGTCTTTCCGCAGGTCCGCGTTTCCTGTTTTCCGTAAATCCGCCTTTGCGGCTGCCCTGCTGT
CCGCAACCGTCCTCGCCGGTTGCGCCACCGCGCCGAAACCGCCGCAGATCAGCTACGATAGCACTGTTCC
ACCACTTCCGTCGGTCCCGGCAGTCATCACGGATCAGCGGCCACGTCCGCTGCATACGCCTCCGGCCTGG
ATCCCGGCCCGGGGCGGCAATTCCGCGAGCACGCCGACCGCGCGCGTCGAGAACGCCAACGCCGCCGCGC
GTGTCGAGCCGCGGCGAGACGGCTATTACAACTCCATCCAGATCTATCCCTGGAGTGAAGGGGCCCTCTA
TCAGGTCTATGCCGCGCCCGGGCAGATCACGAATATCGCGCTTGAGCCGGGCGAAAACCTGACCGGAGCA
GGTCCGATCGCCGCCGGTGACACGGCCAGGTGGATTATCGGCGACACCGAAAGCGGCTCGGGCGTGACCC
GCCGCGTCCATGTGCTCGTGAAGCCGACCAGGACCGACATCACGACCAATCTCGTCATCACGACCGATCG
GCGCGTCTACATGATCGAACTGCGCGCGGGCACGAACCCCTATATGCCCGCCGTGGCATGGGCCTATCCC
GAGCCCCCAGCCAGCCAACGCGCCAACGTCCCGGCGAGGCCCGTCGTTCCTGCCGCGACTGCGCGCAACT
ATCGCTATGGCCTGATGGGCGATACGCCCCCATGGCGTCCGGTCTCGGTCTATGACGATGGGCGGCGCGT
CTACGTCGAATTCCCGCGCGGCATCGTCCAGGGCGAGATGCCGCCGATCTTCGTCATCGGCTCCGACGGC
GAGCCGCAAATCGTCAACAGCCGCATCTACCAGAACATCCTGATCGTCGATCGCATCTTTGGTGCAGCCG
AACTGCGTCTCGGAGGCGGCGATCGTCAGCAGACCGTCAGGATCGTCCGTACTGACGGGAGGCCCGCATC
ATGA
 Primer design