SecReT4
Protein ID: 337739773
T4SS name [ID]Trb [347]
Gene symbol-
Locus tagOCA5_c05360
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_015684] [Browse all T4SS(s) in this replicon]
Location [Strand]561629..561961 [+]
Producthypothetical protein
Component typeTrbC
UniProt IDB6JJW3
KEGG IDoca:OCAR_7607, ocg:OCA5_c05360
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.8e-24, Aligned region: 7..100
Protein Sequence: 110 a.a.     [Download]
>gi|337739773|ref|YP_004631501.1| hypothetical protein OCA5_c05360 [Oligotropha carboxidovorans OM5]
MSHRALRIRHYITTTIATVSISMMLVPAAHASGSSMPWEQPLQQILQSIEGPVAKIVAVIIIIATGLALA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|337739247|ref|NC_015684.1|:561629-561961 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGAGCCATCGTGCCTTGCGTATCCGCCATTACATCACCACGACCATCGCCACCGTATCCATCAGCATGA
TGCTGGTGCCGGCCGCTCATGCCTCCGGCTCGTCGATGCCGTGGGAACAGCCACTTCAGCAAATCCTCCA
GTCGATCGAGGGGCCTGTCGCCAAGATCGTCGCCGTTATCATCATCATCGCGACCGGCCTTGCGCTCGCT
TTCGGCGACACGTCCGGCGGCTTCCGCCGCCTGATCCAGATCGTGTTCGGCCTGTCGATCGCGTTCGCGG
CCAGCTCGTTCTTCTTGAGTTTCTTTTCGTTCGGCGGCGGGGCGTTGGTCTGA
 Primer design