SecReT4
Protein ID: 337739780
T4SS name [ID]Trb [347]
Gene symboltrbG2
Locus tagOCA5_c05430
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_015684] [Browse all T4SS(s) in this replicon]
Location [Strand]567809..568765 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDB6JJV6
KEGG IDoca:OCAR_7600, ocg:OCA5_c05430
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.2e-63, Aligned region: 95..311
Protein Sequence: 318 a.a.     [Download]
>gi|337739780|ref|YP_004631508.1| conjugal transfer protein TrbG [Oligotropha carboxidovorans OM5]
MSTPFRKSAFPVLLLSATMLAGCATYKPPQISYDADVPPLPAMPASVTDDRPKPLHIPPAWTPAKGGTAA
GTPVGRVENANAAARVQPRREGYYNAIQIYPWSDGALYQVYAAPGQITDIALEPGESLTGAGPIAAGDTA
RWIIGDTESGSGVTRRVHVLVKPSRADITTNLVITTDRRTYMVELRSGEKPYMPAVAWAYPQSPADRRAG
VPATPIIPVAAARNYRYALTGDTPPWKPVAVYDDGRRVYVEFPRGIVQGEMPPIFVIGADGEAQIVNSRI
YHNILIVDRLFGAAELRLGSGKHQKTVRIVRTDGRPSS
 
Nucleotide Sequence: 957 bp     [Download]
>gi|337739247|ref|NC_015684.1|:567809-568765 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGAGCACGCCTTTCCGTAAATCCGCCTTTCCGGTTTTGCTGCTCTCCGCGACCATGCTCGCAGGCTGCG
CCACCTACAAGCCGCCGCAGATCAGCTACGACGCCGATGTGCCGCCGTTGCCGGCCATGCCCGCATCCGT
CACCGACGATCGGCCAAAGCCGTTGCACATTCCGCCGGCCTGGACGCCGGCGAAGGGCGGCACCGCGGCC
GGCACGCCGGTCGGCCGCGTCGAGAACGCCAATGCTGCCGCCCGTGTGCAGCCGCGCCGCGAAGGTTATT
ACAATGCGATCCAGATTTATCCGTGGAGCGATGGCGCGCTCTATCAGGTCTATGCCGCGCCCGGCCAGAT
CACCGACATCGCGCTCGAACCCGGCGAGAGCCTGACCGGCGCGGGACCGATCGCCGCGGGCGACACCGCC
CGATGGATCATCGGCGACACGGAAAGCGGATCGGGCGTGACGCGCCGGGTGCATGTGCTGGTGAAGCCCT
CGCGTGCCGACATCACCACCAACCTCGTCATTACCACCGATCGGCGCACCTACATGGTCGAGCTGCGCTC
CGGTGAGAAACCCTACATGCCCGCCGTCGCCTGGGCCTATCCGCAATCGCCGGCAGATCGACGCGCGGGC
GTTCCCGCAACCCCAATCATCCCGGTCGCCGCCGCGCGCAACTATCGCTATGCGCTCACCGGCGACACGC
CGCCGTGGAAGCCGGTCGCGGTCTATGACGATGGCCGCAGAGTGTATGTCGAGTTTCCGCGCGGCATCGT
GCAGGGCGAAATGCCGCCGATCTTCGTCATCGGCGCGGACGGCGAAGCGCAGATCGTCAACAGCCGCATC
TACCACAACATCCTGATCGTGGACCGCCTGTTCGGCGCGGCCGAGCTGCGCCTTGGCAGTGGCAAACACC
AGAAAACCGTCAGAATTGTCCGCACGGACGGGAGGCCATCGTCATGA
 Primer design