SecReT4
Protein ID: 337740850
T4SS name [ID]Trb [348]
Gene symboltrbL3
Locus tagOCA5_c16230
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_015684] [Browse all T4SS(s) in this replicon]
Location [Strand]1757835..1759241 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB6JHP1
KEGG IDoca:OCAR_6425, ocg:OCA5_c16230
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.5e-51, Aligned region: 36..260
Protein Sequence: 468 a.a.     [Download]
>gi|337740850|ref|YP_004632578.1| conjugal transfer protein TrbL [Oligotropha carboxidovorans OM5]
MNTGVIDRFLETFTRYIDSGFGLLGGEIGFLTSTLIVIDITLAGLFWAWGADEDVLARLVKKTLYIGFFA
FIIGNFNKLAGIVFQSFSGLGLKAGGSSMTADTLLQPGRVAQVGIDAGTPILKAAGDLMGYISFFENFVQ
IMVLMIAWAIVLIAFFILAVQIFVTLIEFKLTTLAGFVLIPFALFNKTAFLAEKVLGNIVASGIKILVLA
VIVGIGSGLFSEFTTGFSGTPTITDALALVLGALSLMGLSIFGPGIATGLVSGAPQLGAGAAVGTGLAAA
GIGAAGVMGATAGISGAASAIGTGGRLSAASARGGAYLAGGVAQSYGQSASASGASGMRKAAAGVGGVAK
AGAGAAVQPVRQAVSRATQSLRSGADSLRSSYAAGRAAASNAAGGQASAGSAVAAGNTSTGGATGAGAAA
SSAPPNWAARMKRSQTMSHGATAAAHAVRSGDHGGGSMSVSLDQDDRK
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|337739247|ref|NC_015684.1|:1757835-1759241 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGAACACCGGCGTCATCGACCGCTTTCTGGAGACCTTCACCCGCTACATCGATTCAGGCTTCGGTCTGC
TCGGCGGCGAGATCGGATTCCTCACCTCCACGCTGATCGTCATCGACATCACGCTGGCCGGCCTATTCTG
GGCGTGGGGCGCTGATGAAGACGTACTTGCGCGTCTCGTCAAGAAGACACTTTATATCGGCTTCTTCGCC
TTCATCATCGGCAACTTCAACAAGCTCGCCGGCATCGTCTTCCAGTCCTTCAGCGGCCTCGGCCTGAAGG
CCGGCGGATCGTCGATGACGGCCGACACGCTGCTTCAACCCGGCCGTGTCGCGCAGGTCGGCATCGACGC
CGGCACTCCCATCCTCAAGGCCGCTGGCGACCTGATGGGCTACATCTCCTTCTTCGAGAACTTCGTGCAG
ATCATGGTGCTGATGATCGCCTGGGCGATCGTGCTCATCGCCTTTTTCATCCTCGCCGTCCAGATCTTCG
TCACGTTGATCGAGTTCAAGCTCACGACCTTAGCCGGGTTCGTCCTGATCCCCTTCGCGCTGTTCAACAA
GACCGCGTTCCTCGCCGAAAAGGTGCTTGGCAACATCGTTGCCTCCGGCATCAAGATATTGGTGCTCGCC
GTCATCGTCGGCATCGGCTCCGGCCTGTTCAGTGAGTTCACGACCGGATTCTCCGGCACGCCGACCATCA
CCGACGCGCTGGCACTCGTGCTCGGTGCGCTGTCGCTGATGGGCCTGTCGATCTTCGGTCCCGGTATCGC
CACCGGGCTCGTCTCCGGCGCACCGCAACTCGGTGCGGGAGCCGCCGTTGGCACCGGCCTTGCCGCCGCC
GGCATCGGCGCGGCTGGCGTGATGGGAGCGACAGCGGGCATTTCCGGCGCGGCGAGCGCGATCGGAACCG
GCGGCCGCTTGTCGGCGGCAAGCGCACGCGGCGGCGCATACCTCGCGGGCGGCGTCGCCCAATCCTACGG
GCAGTCGGCTTCGGCCTCTGGCGCATCCGGTATGAGGAAGGCGGCTGCCGGCGTCGGTGGCGTGGCCAAG
GCTGGCGCTGGAGCGGCTGTTCAACCGGTCCGGCAGGCGGTGTCGCGCGCCACCCAATCCCTTCGGTCGG
GGGCGGATTCCCTTCGGTCGAGTTATGCGGCGGGCCGGGCCGCCGCATCGAACGCTGCCGGTGGACAGGC
ATCTGCGGGGTCGGCGGTCGCTGCGGGCAATACCTCAACGGGCGGGGCGACAGGTGCGGGAGCAGCGGCT
TCGTCGGCGCCGCCCAACTGGGCCGCGCGCATGAAACGCAGCCAGACCATGAGCCACGGCGCGACCGCCG
CCGCCCATGCCGTGCGCTCTGGCGATCACGGCGGCGGCTCCATGTCCGTTTCTCTCGACCAGGATGACCG
CAAATGA
 Primer design