SecReT4
Protein ID: 337740852
T4SS name [ID]Trb [348]
Gene symboltrbG3
Locus tagOCA5_c16250
StrainOligotropha carboxidovorans OM5
Repliconchromosome [GenBank: NC_015684] [Browse all T4SS(s) in this replicon]
Location [Strand]1759924..1760964 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDB6JHN9
KEGG IDoca:OCAR_6423, ocg:OCA5_c16250
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.6e-70, Aligned region: 111..334
Protein Sequence: 346 a.a.     [Download]
>gi|337740852|ref|YP_004632580.1| conjugal transfer protein TrbG [Oligotropha carboxidovorans OM5]
MGNNMKNAARRSLRRLSVLVAIILATTALAGCANKFIPPDINYDDAAPAVLSADPVGPVKVVELPKPLPL
PGQLKPVNAGKTKPEPADPKKRVAQANEAARMQPVRNGFINAVQVYPFVVGALYQVYAAPGQVTDIALQP
GEQLVGAGPVAAGDTVRWIVGDTLSGSGRAAQVHILVKPTRPDLQTNLVINTNLRTYHMELRSTEKTYMA
SVSWQYPQDQLIALRRRNQQAALMQPVASGVDISKLNFRYQIEGDDAPWRPLRAFDDGNKIYIEFPSGIG
QGEMPPLFVIGPSGNSELVNYRARQNYYVVDRLFAAAELRLGDKDSEKRVRIVRTDGRPGRGLRLF
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|337739247|ref|NC_015684.1|:1759924-1760964 Oligotropha carboxidovorans OM5 chromosome, complete genome
ATGGGGAACAATATGAAGAATGCCGCGCGCAGAAGCTTGCGTCGGTTGTCAGTGCTGGTCGCCATAATCC
TAGCGACGACGGCGCTCGCCGGCTGCGCCAACAAGTTCATTCCGCCGGACATCAATTACGACGATGCCGC
GCCCGCTGTGCTCAGCGCCGATCCCGTCGGTCCGGTGAAGGTGGTCGAGCTGCCGAAGCCGTTGCCGCTG
CCGGGCCAGTTGAAGCCCGTCAATGCGGGAAAGACGAAACCCGAACCGGCCGATCCGAAGAAGCGCGTGG
CGCAAGCGAACGAAGCGGCACGGATGCAGCCCGTGCGCAACGGCTTCATCAATGCCGTGCAGGTCTATCC
GTTCGTCGTCGGCGCACTCTATCAGGTCTATGCCGCGCCCGGACAAGTAACCGACATCGCGCTTCAGCCC
GGCGAGCAGCTTGTGGGAGCCGGGCCGGTCGCCGCGGGCGACACCGTGCGCTGGATCGTCGGCGACACGC
TCAGCGGCTCCGGTCGCGCCGCGCAGGTCCACATCCTGGTCAAGCCGACGCGGCCCGATCTTCAAACCAA
CCTCGTCATCAACACTAACCTGCGCACCTACCACATGGAGCTGCGATCGACCGAGAAGACTTACATGGCT
TCGGTATCGTGGCAGTATCCGCAGGACCAGTTGATCGCGCTGCGCCGGCGGAACCAACAGGCTGCGCTCA
TGCAGCCGGTCGCGTCCGGCGTCGATATCTCGAAACTAAACTTCCGCTATCAGATCGAAGGCGACGACGC
GCCGTGGCGGCCGCTGCGCGCCTTCGACGACGGCAACAAAATCTATATCGAGTTTCCGTCCGGGATCGGC
CAGGGCGAGATGCCGCCGCTGTTCGTCATCGGACCGTCTGGCAATTCCGAATTGGTCAACTACCGCGCCC
GCCAGAACTATTACGTCGTCGATCGTCTGTTCGCCGCGGCCGAACTGCGCCTGGGCGACAAGGACAGCGA
GAAGCGCGTGCGCATCGTGCGCACCGACGGCCGGCCGGGGCGTGGCCTGAGGTTGTTCTGA
 Primer design