SecReT4
Protein ID: 338815027
T4SS name [ID]Tcp [635]
Gene symboltcpG
Locus tagpCPPB1_p40
StrainClostridium perfringens plasmid pCPPB-1 (NC_015712)
Repliconplasmid pCPPB-1 [GenBank: NC_015712] [Browse all T4SS(s) in this replicon]
Location [Strand]36435..37439 [-]
Productcell wall-binding protein TcpG
Component typeTcpG
UniProt IDF7J0B8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Glucosaminidase [PF01832], Evalue: 3.8e-41, Aligned region: 54..188
NLPC_P60 [PF00877], Evalue: 2.1e-27, Aligned region: 218..328
Protein Sequence: 334 a.a.     [Download]
>gi|338815027|ref|YP_004670338.1| cell wall-binding protein TcpG [Clostridium perfringens]
MKKIFIWSGIISLIFPLLFFFLIIGGSGEQPTPVNPNPNLTEEQLNFISQIVSGAKQSYEETGIFPSITL
AQAILESGWGRSGLAIKANNLFGIKADSGWKGKVLEMPTQEYVNGGIITIIARWRVYESCNESVIDHGKF
FVENSRYKENGVLDATNYIEQAQCIQKAGYATDPNYANQLIQVINDFGLNIYDMNGNVVGNDVIEKAIEA
GMKLVSKSPYVWGGGRNQSDVDAGRFDCSSLVHYCYASAGITLGPRESVTTWSLINMGKPVPASEMKRGD
LIFFDTAGRNGHIGIYLGNGKFLNDSSTQGVSIGDLNSAYWSRYFNGNVRRVVE
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|338814987|ref|NC_015712.1|:c37439-36435 Clostridium perfringens plasmid pCPPB-1, complete sequence
ATGAAAAAGATTTTTATATGGAGTGGGATAATATCTTTGATATTTCCACTTCTATTTTTTTTCTTAATTA
TAGGGGGAAGTGGCGAGCAGCCAACTCCAGTAAATCCTAATCCTAATTTAACGGAAGAGCAGCTTAATTT
TATAAGTCAGATTGTTTCCGGAGCGAAGCAATCCTATGAAGAAACAGGAATATTTCCATCAATAACCCTG
GCACAAGCTATATTAGAAAGTGGTTGGGGAAGATCTGGGTTGGCCATAAAAGCTAATAATTTATTTGGTA
TAAAAGCTGACTCTGGATGGAAGGGGAAAGTTTTAGAAATGCCAACTCAGGAGTATGTTAATGGTGGAAT
AATAACTATTATAGCAAGATGGAGAGTTTATGAAAGTTGTAATGAATCTGTAATAGATCATGGTAAATTC
TTTGTAGAAAATTCTAGATATAAAGAAAATGGAGTCCTGGACGCAACTAACTATATAGAGCAAGCTCAAT
GTATACAAAAAGCGGGGTATGCAACAGATCCAAACTATGCAAACCAATTAATCCAGGTAATAAATGATTT
TGGACTAAATATTTACGACATGAACGGAAATGTTGTAGGGAATGATGTTATAGAAAAAGCAATAGAAGCT
GGAATGAAATTGGTTAGCAAATCTCCATATGTTTGGGGAGGAGGTCGTAACCAATCTGACGTTGATGCAG
GACGATTTGATTGTAGTTCCTTAGTACATTATTGTTATGCATCTGCAGGAATAACTTTAGGGCCAAGAGA
AAGTGTAACCACATGGTCCTTAATAAACATGGGTAAACCTGTACCTGCAAGTGAAATGAAGCGTGGAGAC
TTAATATTCTTCGATACTGCTGGAAGGAACGGACATATAGGCATCTACCTTGGAAATGGAAAATTCTTGA
ATGATAGTTCTACTCAGGGAGTAAGTATTGGGGACTTAAATAGTGCTTATTGGAGCAGATATTTTAATGG
AAATGTAAGAAGAGTCGTAGAATAA
 Primer design