SecReT4
Protein ID: 339319741
T4SS name [ID]VirB [509]
Gene symbolvirD4
Locus tagmidi_00443
StrainCandidatus Midichloria mitochondrii IricVA
Repliconchromosome [GenBank: NC_015722] [Browse all T4SS(s) in this replicon]
Location [Strand]413626..415011 [-]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDF7XVQ1
KEGG IDmmn:midi_00443
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.8e-148, Aligned region: 8..426
TraG-D_C [PF12696], Evalue: 3.9e-27, Aligned region: 266..388
TrwB_AAD_bind [PF10412], Evalue: 3.8e-25, Aligned region: 99..402
AAA_10 [PF12846], Evalue: 3.5e-06, Aligned region: 18..343
Protein Sequence: 461 a.a.     [Download]
>gi|339319741|ref|YP_004679436.1| type IV secretion system protein VirD4 [Candidatus Midichloria mitochondrii IricVA]
MLIGRDKKGFLVASGYQHALLFAPTGSGKGVGFVIPNLLYWQDSVFVHDIKLENYELTSGWRQKMGQKVY
CWNPANPDGITHCYNPIDWISTKPGQMVDDVQKIANLIMPEKEFWNNEARSLFVGVVLYLVAAKDKIRSF
GEVVRTMRSDDVVYNLAVVLDTLGNDIHPVAYMNIAAFLQKADKERSGVISTMNSNLELWANPLIDTATA
SSDFNVSEFKKKLTTVYVGLTPDNLQRLQPLMQVFYQQCTEFLSRKMPGPDEPYGVMFMMDEFPTLGKME
QFMTGIAYFRGYHVRLFLIIQDTEQLKGIYEEHGMNSFLSNTTYRITFAANNVETANLISQLVGNKTVDQ
VSTSKPKFLDFNPASRSLNVSQTQRALLLPQEVIGLPRDEQIILIESSPPIKSKKIKYYEEKFFKSRLLK
ATPVPQQEPFDPRKFKESLQSKKTNAEDGNDANSAEAVTNQ
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|339319317|ref|NC_015722.1|:c415011-413626 Candidatus Midichloria mitochondrii IricVA chromosome, complete genome
ATGCTAATTGGTAGAGATAAAAAAGGATTTTTAGTAGCCAGCGGTTATCAACATGCCCTTTTATTTGCTC
CAACCGGCTCTGGTAAAGGTGTTGGATTTGTCATTCCTAATCTACTTTATTGGCAAGATTCAGTGTTTGT
TCATGATATTAAACTCGAGAACTATGAGTTAACAAGCGGTTGGCGGCAAAAAATGGGGCAGAAAGTCTAT
TGCTGGAATCCTGCTAACCCTGATGGAATTACACACTGCTACAACCCAATAGATTGGATTAGTACGAAGC
CAGGTCAGATGGTGGATGATGTGCAAAAGATTGCAAATTTAATTATGCCAGAAAAAGAATTTTGGAATAA
CGAAGCGCGCTCTTTATTCGTTGGTGTGGTTTTATATTTAGTGGCTGCAAAAGATAAAATTAGGTCTTTT
GGTGAAGTTGTACGCACTATGAGAAGTGACGACGTAGTTTACAATCTAGCTGTAGTTTTAGATACTTTAG
GAAATGATATACACCCAGTTGCCTATATGAATATAGCCGCCTTTTTACAAAAAGCTGATAAAGAAAGGTC
GGGGGTAATTTCTACAATGAACTCTAATCTTGAGTTATGGGCTAATCCTCTAATTGATACAGCAACCGCA
AGCAGCGACTTTAATGTTTCAGAATTCAAGAAAAAGCTCACTACAGTTTATGTTGGTTTAACCCCTGATA
ACCTGCAAAGATTGCAACCATTAATGCAGGTATTTTACCAACAATGTACGGAATTTTTATCAAGAAAAAT
GCCAGGACCAGATGAGCCATATGGTGTTATGTTTATGATGGACGAATTCCCAACTCTTGGAAAAATGGAA
CAGTTTATGACTGGTATCGCATATTTTAGAGGGTATCACGTTAGACTATTTTTAATCATCCAAGATACAG
AGCAGCTCAAAGGTATCTATGAAGAACACGGTATGAATTCATTCTTATCAAATACCACTTATAGGATAAC
ATTTGCTGCTAATAACGTTGAAACTGCAAACCTTATATCCCAGTTAGTTGGTAATAAAACCGTTGACCAA
GTTTCAACCAGTAAACCTAAATTCTTAGACTTCAATCCCGCCTCCAGGTCTTTAAATGTCTCTCAAACGC
AACGTGCTTTACTTTTGCCACAAGAAGTGATTGGATTACCTCGCGATGAACAGATTATCTTAATTGAGTC
TAGTCCGCCTATCAAATCTAAAAAGATAAAATATTATGAAGAAAAATTCTTTAAAAGTAGGTTACTTAAG
GCAACTCCTGTACCCCAACAAGAGCCTTTTGATCCAAGAAAGTTTAAAGAAAGCTTACAATCTAAAAAAA
CCAATGCCGAAGACGGTAATGATGCTAACTCTGCTGAAGCAGTTACTAATCAATAA
 Primer design