SecReT4
Protein ID: 339319742
T4SS name [ID]VirB [509]
Gene symbolvirB11
Locus tagmidi_00444
StrainCandidatus Midichloria mitochondrii IricVA
Repliconchromosome [GenBank: NC_015722] [Browse all T4SS(s) in this replicon]
Location [Strand]415440..416423 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDF7XVQ2
KEGG IDmmn:midi_00444
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.2e-86, Aligned region: 10..309
Protein Sequence: 327 a.a.     [Download]
>gi|339319742|ref|YP_004679437.1| type IV secretion system protein VirB11 [Candidatus Midichloria mitochondrii IricVA]
MSLAALETYLEPLKNLFAEEGVNEISINRPAEAWVEKKGDIRQEVLTQLDFNHLRELAQLIAQSTEQTIS
EETPLLSATLPTGFRIQIVIPPACEPGTIGMSIRKPSSMNLDLDGYEELGTFDNIAVEEEVDNNTLVLKD
LLIKKDIKNFLLESVLRKKNIIISGGTSTGKTTFTNAMLRAIPIEERIITCEDAREIDLKDHPNRIHLLA
SKGGQGRAKVTTQDLIEACLRLRPDRIIVGELRGADAFSFLRAINTGHPGSISTLHADTPKMALEQLKLM
VMQAGLGMPPDQIKEYILNVVDIVVQLKRGAKGRRYVSEIYFKGAQH
 
Nucleotide Sequence: 984 bp     [Download]
>gi|339319317|ref|NC_015722.1|:c416423-415440 Candidatus Midichloria mitochondrii IricVA chromosome, complete genome
ATGAGTTTAGCAGCGTTAGAAACTTATCTAGAACCATTAAAAAATCTCTTTGCCGAAGAGGGAGTAAATG
AAATATCTATTAATAGACCAGCAGAAGCCTGGGTGGAAAAAAAAGGAGATATTAGGCAAGAAGTCCTTAC
CCAATTGGATTTTAATCACCTAAGAGAGCTTGCACAGTTAATTGCTCAGTCAACCGAGCAAACTATTAGC
GAAGAAACCCCTCTTCTGTCGGCTACATTGCCAACTGGATTTAGGATACAAATTGTTATTCCTCCTGCCT
GTGAGCCAGGAACTATAGGTATGTCTATAAGAAAGCCCTCTTCAATGAACTTGGATCTTGACGGCTATGA
AGAATTAGGGACTTTTGATAATATTGCAGTTGAAGAAGAGGTTGATAATAATACTCTTGTACTTAAAGAT
TTACTGATCAAAAAAGATATCAAAAACTTTTTATTAGAATCGGTATTAAGAAAGAAAAATATAATAATAA
GTGGTGGTACCTCAACTGGTAAAACTACGTTTACCAACGCCATGCTTAGAGCTATACCTATTGAGGAAAG
GATTATCACCTGCGAAGATGCTAGGGAGATTGACCTAAAAGATCATCCGAATAGAATACATCTACTTGCC
TCTAAGGGCGGCCAAGGTAGAGCTAAAGTTACCACTCAAGACTTAATAGAAGCCTGCTTAAGGTTAAGAC
CCGATAGAATAATCGTGGGTGAGCTACGGGGGGCTGATGCCTTCAGTTTTTTAAGAGCTATCAATACCGG
GCACCCGGGTTCGATTTCTACTTTACACGCTGACACTCCTAAGATGGCACTAGAACAGTTAAAACTAATG
GTAATGCAAGCGGGCCTTGGTATGCCTCCTGATCAAATTAAGGAATATATATTGAATGTCGTTGATATTG
TAGTACAGTTAAAGAGAGGCGCCAAAGGAAGAAGATACGTATCTGAGATTTACTTCAAAGGCGCACAACA
TTAA
 Primer design